TCF25 (Myc-DDK-tagged)-Human transcription factor 25 (basic helix-loop-helix) (TCF25)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TCF25 (Myc-DDK-tagged)-Human transcription factor 25 (basic helix-loop-helix) (TCF25)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human transcription factor 25 (basic helix-loop-helix) (TCF25)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Tcf25 (Myc-DDK-tagged) - Mouse transcription factor 25 (basic helix-loop-helix) (Tcf25), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TCF25 (GFP-tagged) - Human transcription factor 25 (basic helix-loop-helix) (TCF25)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
TCF25 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Tcf25 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Tcf25 (GFP-tagged) - Mouse transcription factor 25 (basic helix-loop-helix) (Tcf25), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Tcf25 (GFP-tagged) - Mouse transcription factor 25 (basic helix-loop-helix) (cDNA clone MGC:36794 IMAGE:3498003)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Tcf25 (GFP-tagged) - Mouse transcription factor 25 (basic helix-loop-helix) (Tcf25) transcript variant 2, (10ug)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Tcf25 (Myc-DDK-tagged) - Mouse transcription factor 25 (basic helix-loop-helix) (Tcf25), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Tcf25 (Myc-DDK-tagged) - Mouse transcription factor 25 (basic helix-loop-helix) (Tcf25), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Tcf25 (mGFP-tagged) - Mouse transcription factor 25 (basic helix-loop-helix) (Tcf25), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Tcf25 (GFP-tagged) - Mouse transcription factor 25 (basic helix-loop-helix) (Tcf25), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Tcf25 (Myc-DDK-tagged) - Mouse transcription factor 25 (basic helix-loop-helix) (Tcf25), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Tcf25 (Myc-DDK-tagged) - Mouse transcription factor 25 (basic helix-loop-helix) (Tcf25), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Tcf25 (Myc-DDK-tagged) - Mouse transcription factor 25 (basic helix-loop-helix) (Tcf25), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Tcf25 (mGFP-tagged) - Mouse transcription factor 25 (basic helix-loop-helix) (Tcf25), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Tcf25 (GFP-tagged) - Mouse transcription factor 25 (basic helix-loop-helix) (Tcf25), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Tcf25 (Myc-DDK-tagged) - Mouse transcription factor 25 (basic helix-loop-helix) (Tcf25), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Tcf25 (Myc-DDK-tagged) - Mouse transcription factor 25 (basic helix-loop-helix) (Tcf25), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Tcf25 (Myc-DDK-tagged) - Mouse transcription factor 25 (basic helix-loop-helix) (Tcf25), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Tcf25 (mGFP-tagged) - Mouse transcription factor 25 (basic helix-loop-helix) (Tcf25), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Tcf25 (GFP-tagged) - Mouse transcription factor 25 (basic helix-loop-helix) (Tcf25), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Tcf25 (myc-DDK-tagged) - Mouse transcription factor 25 (basic helix-loop-helix) (Tcf25), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Tcf25 (myc-DDK-tagged) - Mouse transcription factor 25 (basic helix-loop-helix) (Tcf25), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human transcription factor 25 (basic helix-loop-helix) (TCF25), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,010.00
6 Weeks
Lenti ORF particles, TCF25 (Myc-DDK tagged) - Human transcription factor 25 (basic helix-loop-helix) (TCF25), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human transcription factor 25 (basic helix-loop-helix) (TCF25), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,010.00
6 Weeks
Lenti ORF particles, TCF25 (mGFP-tagged) - Human transcription factor 25 (basic helix-loop-helix) (TCF25), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Tcf25 (untagged) - Mouse transcription factor 25 (basic helix-loop-helix) (Tcf25), transcript variant 3, (10ug)
Vector | PCMV6-Kan/Neo |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-NULP1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-NULP1 antibody is: synthetic peptide directed towards the N-terminal region of Human NULP1. Synthetic peptide located within the following region: DLRDDDDAEEEGPKRELGVRRPGGAGKEGVRVNNRFELINIDDLEDDPVV |
Tcf25 (untagged) - Mouse transcription factor 25 (basic helix-loop-helix) (Tcf25), transcript variant 2, (10ug)
Vector | PCMV6-Kan/Neo |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal antibody to NULP1 (transcription factor 25 (basic helix-loop-helix))
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 427 and 676 of NULP1 (Uniprot ID#Q9BQ70) |
USD 121.00
In Stock
TCF25 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Tcf25 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit polyclonal TCF25 Antibody (N-term)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This TCF25 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from the N-terminal region of human TCF25. |
Transient overexpression lysate of transcription factor 25 (basic helix-loop-helix) (TCF25)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-TCF25 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TCF25 antibody: synthetic peptide directed towards the N terminal of human TCF25. Synthetic peptide located within the following region: HRHLNPDTELKRYFGARAILGEQRPRQRQRVYPKCTWLTTPKSTWPRYSK |
Rabbit Polyclonal Anti-TCF25 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TCF25 antibody: synthetic peptide directed towards the N terminal of human TCF25. Synthetic peptide located within the following region: SGKLRKKKKKQKNKKSSTGEASENGLEDIDRILERIEDSTGLNRPGPAPL |
TCF25 CRISPRa kit - CRISPR gene activation of human transcription factor 25
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Tcf25 CRISPRa kit - CRISPR gene activation of mouse transcription factor 25 (basic helix-loop-helix)
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene TCF25
Tcf25 (untagged) - Mouse transcription factor 25 (basic helix-loop-helix) (Tcf25), transcript variant 4
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Tcf25 (untagged) - Mouse transcription factor 25 (basic helix-loop-helix) (Tcf25), transcript variant 5
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
qPCR primer pairs and template standards against Mus musculus gene Tcf25
Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Mus musculus gene Tcf25
Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against mus musculus gene Tcf25
Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
TCF25 MS Standard C13 and N15-labeled recombinant protein (NP_055787)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
TCF25 (untagged)-Human transcription factor 25 (basic helix-loop-helix) (TCF25)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
3`UTR clone of transcription factor 25 (basic helix-loop-helix) (TCF25) for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |