Rabbit anti-KNG1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Mouse, Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human KNG1 |
Rabbit anti-KNG1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Mouse, Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human KNG1 |
Rabbit Polyclonal antibody to Kininogen 1 (kininogen 1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 416 of HMW Kininogen |
Bradykinin; neat antiserum
Applications | ELISA |
Reactivities | Human, Mammalian |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide H-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg-OH coupled to a carrier protein. |
KNG1 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KNG1 |
Kininogen 1 (KNG1) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 145-174 amino acids from the N-terminal region of Human Kininogen-1 |
Rabbit polyclonal KNG1 (heavy chain, Cleaved-Lys380) antibody
Applications | WB |
Reactivities | Human:Lys380 |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human KNG1. |
Anti-KNG1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 280 amino acids of human kininogen 1 |
Rabbit Polyclonal Anti-KNG1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KNG1 antibody: synthetic peptide directed towards the middle region of human KNG1. Synthetic peptide located within the following region: YPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFK |
Bradykinin; purified rabbit IgG
Applications | ELISA |
Reactivities | Human, Mammalian |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide H-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg-OH coupled to a carrier protein. |
Bradykinin; diluted antiserum
Applications | ELISA |
Reactivities | Human, Mammalian |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide H-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg-OH coupled to a carrier protein. |
KNG1 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of human KNG1 |
KNG1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human KNG1 |
KNG1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KNG1 |
Kininogen 1 (KNG1) Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 148-427 of human Kininogen 1 (Kininogen 1 (KNG1)) (NP_000884.1). |
Modifications | Unmodified |