Rabbit polyclonal HIF1A Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Hamster |
| Conjugation | Unconjugated |
| Immunogen | This HIF1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human HIF1A. |
Rabbit Polyclonal HIF-1 alpha Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Goat, Hamster, Rabbit, Primate |
| Conjugation | Unconjugated |
| Immunogen | A fusion protein including residues 530-825 of the mouse HIF-1 alpha protein. [UniProt# Q61221] |
Rabbit polyclonal Hif-1 alpha hydroxy P564 antibody
| Applications | WB |
| Reactivities | Bovine, Human, Monkey, Mouse, Rat, Xenopus, Dog |
| Conjugation | Unconjugated |
| Immunogen | This antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region surrounding the P564 of human HIF-1a. |
Rabbit Polyclonal HIF-1 alpha Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Canine, Guinea Pig, Primate, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein made to an internal sequence of human HIF-1 alpha (containing amino acids 432-528) [UniProt Q16665] |
Rabbit polyclonal HMGN phospho S20/S24 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 19-28 of human HMGN protein (see below). |
Rabbit Polyclonal anti-HIF1A antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HIF1A antibody: synthetic peptide directed towards the N terminal of human HIF1A. Synthetic peptide located within the following region: EGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVS |
Rabbit Polyclonal Anti-HIF1A Antibody
| Applications | WB |
| Reactivities | Chicken, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HIF1A antibody: synthetic peptide directed towards the middle region of human HIF1A. Synthetic peptide located within the following region: VKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNA |
Rabbit Polyclonal HIF-1 alpha [Exon 9] Antibody (exon 9)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal portion of the human HIF-1 alpha protein (within residues 350-400). [Swiss-Prot# Q16665] |
Rabbit Polyclonal HIF-1 alpha [Exon 10] Antibody (exon 10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal portion of the human HIF-1 alpha protein (within residues 400-450). [Swiss-Prot# Q16665] |
Rabbit Polyclonal HIF-1 alpha [Exon 12] Antibody (exon 12)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal portion of the human HIF-1 alpha protein (within residues 550-600). [Swiss-Prot# Q16665] |
Rabbit Polyclonal HIF-1 alpha [Exon 13] Antibody (exon 13)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal portion of the human HIF-1 alpha protein (within residues 700-750). [Swiss-Prot# Q16665] |
Rabbit anti HIF, alpha Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A twenty-one amino acids synthetic peptide corresponding to the internal sequence of HIF alpha protein. This sequence is identical to human, rat and mouse origins. |
Rabbit Polyclonal Anti-HIF1A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human HIF1A |
HIF1A rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human HIF1A |
HIF1A rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human HIF1A |
HIF1α Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 70-260 of human HIF1α (NP_851397.1). |
| Modifications | Unmodified |
HIF1α Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HIF1α. |
HIF1α Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 670-826 of human HIF1α (NP_001521.1). |
| Modifications | Unmodified |
HIF1α Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human HIF1α |
| Modifications | Unmodified |
HIF1α Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human HIF1α |
| Modifications | Unmodified |
HIF1 alpha Rabbit polyclonal Antibody
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human HIF-1-alpha |
Germany
Japan
United Kingdom
China
