Goat Polyclonal Antibody against Bradykinin receptor B1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence KVWELYKQCTPK, from the internal region of the protein sequence according to NP_000701.2. |
Goat Polyclonal Antibody against Bradykinin receptor B1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence KVWELYKQCTPK, from the internal region of the protein sequence according to NP_000701.2. |
Rabbit polyclonal anti-BDKRB1 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human BDKRB1. |
Modifications | Phospho-specific |
Goat Anti-F2R / PAR1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-TRARRPESKATNAT, from the Internal region (near N-terminus) of the protein sequence according to NP_001983.2. |
Mouse Monoclonal Thrombin Receptor Antibody (N2-11)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Anti-BDKRB2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 377-391 amino acids of human bradykinin receptor B2 |
Rabbit Polyclonal Anti-Human Protease-activated Receptor-1 (extracellular)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide (C)KNESGLTEYRLVSINK, corresponding to amino acid residues 61-76 of human PAR-1. Extracellular, N terminal. |
Rabbit Polyclonal Anti-BDKRB2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BDKRB2 antibody: synthetic peptide directed towards the N terminal of human BDKRB2. Synthetic peptide located within the following region: MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQV |
Rabbit Polyclonal Anti-Thrombin Receptor Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Thrombin Receptor Antibody: A synthesized peptide derived from human Thrombin Receptor |
Thrombin Receptor (F2R) (24-37) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide from the Internal region (near N-terminus) of the human protein sequence according to NP_001983.2 |
Rabbit polyclonal Thrombin Receptor antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Thrombin Receptor. |
Rabbit polyclonal F2R / PAR1 (Cleaved-Ser42) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human PAR1. |
Rabbit Polyclonal Anti-C3a Anaphylatoxin Receptor (extracellular)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide (C)EDHETSPLDNSD, corresponding to amino acid residues 276-287 of human C3a anaphylatoxin receptor. 2nd extracellular loop. |
C5R1 (C5AR1) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human C5AR1 |
Rabbit Polyclonal Anti-C5a Anaphylatoxin Receptor (extracellular)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide (C)DKDTLDLNTPVDK, corresponding to amino acid residues 16-28 of human C5aR (Accession P21730 ). Extracellular, N-terminus. |
Rabbit Polyclonal Anti-B2 Bradykinin Receptor
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide GKRFRKKSWEVYQG(C), corresponding to amino acid residues 336-349 of human BKRB2. Intracellular, C-terminus. |
Rabbit Polyclonal Anti-BDKRB1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BDKRB1 antibody is: synthetic peptide directed towards the C-terminal region of Human BDKRB1. Synthetic peptide located within the following region: RTREEVSRTRCGGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQ |
BDKRB1 (Center) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human BDKRB1 |
Thrombin Receptor (F2R) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-F2R Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-F2R antibody: synthetic peptide directed towards the N terminal of human F2R. |
Rabbit Polyclonal Anti-F2R Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-F2R antibody: synthetic peptide directed towards the C terminal of human F2R. Synthetic peptide located within the following region: YAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSSAVANRSKKSRALFLSA |
Rabbit Polyclonal Anti-C5AR1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C5AR1 antibody: synthetic peptide directed towards the C terminal of human C5AR1. Synthetic peptide located within the following region: SHDKRRERAVAIVRLVLGFLWPLLTLTICYTFILLRTWSRRATRSTKTLK |
Anti-BDKRB2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 377-391 amino acids of human bradykinin receptor B2 |
Anti-F2R Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 56-70 amino acids of human coagulation factor II (thrombin) receptor |
Rabbit Polyclonal Anti-C3AR1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human C3AR1 |
BDKRB1 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |