Products

View as table Download

USD 320.00

In Stock

Goat Polyclonal Anti-CAV1 Antibody

Applications IF, WB
Reactivities Canine, Human, Mouse
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 100 aa to the N-terminus of human CAV1 produced in E. coli.

Goat Polyclonal Antibody against Caveolin 1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DELSEKQVYDAH, from the internal region of the protein sequence according to NP_001744.2.

Mouse Monoclonal Antibody against Caveolin 1 (7C8)

Applications WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated

Caveolin 1 (CAV1) (1-104) mouse monoclonal antibody, clone AT4C1, Purified

Applications ELISA, FC, IF, WB
Reactivities Human, Rat

Caveolin 1 (CAV1) (1-104) mouse monoclonal antibody, clone AT4C1, Purified

Applications ELISA, FC, IF, WB
Reactivities Human, Rat

Rabbit polyclonal Caveolin-1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Caveolin-1.

Rabbit Polyclonal Anti-Caveolin-1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Caveolin-1 Antibody: A synthesized peptide derived from human Caveolin-1

Rabbit Polyclonal Anti-Caveolin 1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Caveolin 1 Antibody: A synthesized peptide derived from human Caveolin 1

Rabbit Polyclonal Caveolin-1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Caveolin-1

Rabbit Polyclonal Caveolin-1 (Tyr14) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Caveolin-1 around the phosphorylation site of Tyrosine 14
Modifications Phospho-specific

Rabbit Polyclonal Anti-CAV1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CAV1 antibody: synthetic peptide directed towards the N terminal of human CAV1. Synthetic peptide located within the following region: MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEID

Rabbit Polyclonal Anti-CAV1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CAV1 antibody: synthetic peptide directed towards the N terminal of human CAV1. Synthetic peptide located within the following region: SGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDL

Rabbit Polyclonal Anti-Caveolin-1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Caveolin-1 antibody was raised against a peptide corresponding to 18 amino acids near the amino terminus of human Caveolin-1.

Carrier-free (BSA/glycerol-free) CAV1 mouse monoclonal antibody,clone OTI2C4

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-CAV1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CAV1

CAV1 mouse monoclonal antibody,clone OTI2C4

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CAV1 mouse monoclonal antibody,clone OTI2C4, Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

CAV1 mouse monoclonal antibody,clone OTI2C4, HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

CAV1 mouse monoclonal antibody,clone OTI2C4

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated