Rabbit anti-SPAM1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SPAM1 |
Rabbit anti-SPAM1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SPAM1 |
Rabbit anti-GLB1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GLB1 |
Rabbit anti-HPSE Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HPSE |
Rabbit polyclonal antibody to SGSH (N-sulfoglucosamine sulfohydrolase)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 318 and 496 of SGSH (Uniprot ID#P51688) |
Rabbit anti-GALNS Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GALNS |
Rabbit polyclonal anti-GUSB antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GUSB. |
Rabbit polyclonal GALNS Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This GALNS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-263 amino acids from the Central region of human GALNS. |
Rabbit anti-HEXA Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HEXA |
Rabbit polyclonal antibody to SGSH (N-sulfoglucosamine sulfohydrolase)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 44 and 230 of SGSH (Uniprot ID#P51688) |
Anti-HPSE Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a C terminal 250 amino acids of human heparanase |
Rabbit Polyclonal ARSB Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ARSB antibody was raised against a 16 amino acid peptide near the carboxy terminus of human ARSB |
Anti-HPSE Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a C terminal 250 amino acids of human heparanase |
Rabbit polyclonal anti-ARSB antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human ARSB. |
Rabbit Polyclonal Anti-IDUA Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Idua antibody is: synthetic peptide directed towards the middle region of MOUSE Idua. Synthetic peptide located within the following region: MENQLLPGFELMGSPSGYFTDFDDKQQVFEWKDLVSLLARRYIGRYGLTH |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) IDS mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) IDS mouse monoclonal antibody, clone OTI3B10 (formerly 3B10)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) IDS mouse monoclonal antibody, clone OTI4G2 (formerly 4G2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GLB1 mouse monoclonal antibody, clone OTI10B2 (formerly 10B2)
Applications | IF, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 379.00
In Stock
IDS (Iduronate 2 sulfatase) mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
IDS (Iduronate 2 sulfatase) mouse monoclonal antibody, clone OTI1D9 (formerly 1D9), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Biotin |
USD 420.00
4 Weeks
IDS (Iduronate 2 sulfatase) mouse monoclonal antibody, clone OTI1D9 (formerly 1D9), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | HRP |
USD 159.00
2 Days
IDS (Iduronate 2 sulfatase) mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
USD 379.00
In Stock
IDS (Iduronate 2 sulfatase) mouse monoclonal antibody, clone OTI3B10 (formerly 3B10)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
IDS (Iduronate 2 sulfatase) mouse monoclonal antibody, clone OTI3B10 (formerly 3B10), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Biotin |
USD 420.00
4 Weeks
IDS (Iduronate 2 sulfatase) mouse monoclonal antibody, clone OTI3B10 (formerly 3B10), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | HRP |
USD 159.00
In Stock
IDS (Iduronate 2 sulfatase) mouse monoclonal antibody, clone OTI3B10 (formerly 3B10)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
USD 379.00
In Stock
IDS (Iduronate 2 sulfatase) mouse monoclonal antibody, clone OTI4G2 (formerly 4G2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
IDS (Iduronate 2 sulfatase) mouse monoclonal antibody, clone OTI4G2 (formerly 4G2), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
USD 420.00
4 Weeks
IDS (Iduronate 2 sulfatase) mouse monoclonal antibody, clone OTI4G2 (formerly 4G2), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
USD 159.00
2 Days
IDS (Iduronate 2 sulfatase) mouse monoclonal antibody, clone OTI4G2 (formerly 4G2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
GLB1 mouse monoclonal antibody, clone OTI10B2 (formerly 10B2)
Applications | IF, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
GLB1 mouse monoclonal antibody,clone 10B2, Biotinylated
Applications | IF, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
GLB1 mouse monoclonal antibody,clone 10B2, HRP conjugated
Applications | IF, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
GLB1 mouse monoclonal antibody, clone OTI10B2 (formerly 10B2)
Applications | IF, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |