Anti-EXT1 Rabbit Polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 280 amino acids of human exostosin glycosyltransferase 1 |
Anti-EXT1 Rabbit Polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 280 amino acids of human exostosin glycosyltransferase 1 |
EXT1 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human EXT1 |
Rabbit Polyclonal Anti-DENR Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DENR antibody was raised against an 18 amino acid peptide near the center of human DENR. |
Rabbit polyclonal EXT2 Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This EXT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 182-209 amino acids from the Central region of human EXT2. |
Rabbit Polyclonal Antibody against HS2ST1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This HS2ST1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 16-45 amino acids from the N-terminal region of human HS2ST1. |
Rabbit Polyclonal Anti-HS3ST1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-HS3ST1 Antibody: synthetic peptide directed towards the middle region of human HS3ST1. Synthetic peptide located within the following region: TKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELV |
Rabbit Polyclonal Anti-HS2ST1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HS2ST1 antibody: synthetic peptide directed towards the N terminal of human HS2ST1. Synthetic peptide located within the following region: GLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKLERAIARHEVR |
Rabbit Polyclonal Anti-HS2ST1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HS2ST1 antibody: synthetic peptide directed towards the middle region of human HS2ST1. Synthetic peptide located within the following region: GVTEELEDFIMLLEAALPRFFRGATELYRTGKKSHLRKTTEKKLPTKQTI |
EXTL3 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 50~80 amino acids from the N-terminal region of human EXTL3 |
HS3ST2 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 324~354 amino acids from the C-terminal region of Human HS3ST2 |
Rabbit Polyclonal Anti-XYLT2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-XYLT2 antibody: synthetic peptide directed towards the middle region of human XYLT2. Synthetic peptide located within the following region: PMGTPLCRFEPRGLPSSVHLYFYDDHFQGYLVTQAVQPSAQGPAETLEMW |
Rabbit Polyclonal Anti-XYLT2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-XYLT2 antibody: synthetic peptide directed towards the C terminal of human XYLT2. Synthetic peptide located within the following region: LRPGPWTVRLLQFWEPLGETRFLVLPLTFNRKLPLRKDDASWLHAGPPHN |
Rabbit Polyclonal Anti-B3GAT1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human B3GAT1 |
EXTL3 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 352-382 amino acids from the N-terminal region of human EXTL3 |
Rabbit anti-B3GAT1 polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from Human CD57. |
HS3ST1 Goat Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | C Terminus (NKLHEYFHEPNKK) |
B3GAT2 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 130-158 amino acids from the Central region of human B3GAT2 |
B3GAT3 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 300-329 amino acids from the C-terminal region of human B3GAT3 |
EXT1 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 297-326 amino acids from the Central region of Human EXT1 |
EXTL2 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 280~310 amino acids from the C-terminal region of human EXTL2. |
XYLT1 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 133-163 amino acids from the N-terminal region of human XYLT1 |
Rabbit polyclonal Anti-HS6ST3 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HS6ST3 antibody: synthetic peptide directed towards the C terminal of human HS6ST3. Synthetic peptide located within the following region: TKQLEHQRDRQKRREERRLQREHRDHQWPKEDGAAEGTVTEDYNSQVVRW |
Rabbit polyclonal Anti-HS3ST5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HS3ST5 antibody: synthetic peptide directed towards the C terminal of human HS3ST5. Synthetic peptide located within the following region: SQYNLYFNATRGFYCLRFNIIFNKCLAGSKGRIHPEVDPSVITKLRKFFH |
Rabbit Polyclonal Anti-B3GAT1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-B3GAT1 antibody is: synthetic peptide directed towards the N-terminal region of Human B3GAT1. Synthetic peptide located within the following region: LAPLLAVHKDEGSDPRRETPPGADPREYCTSDRDIVEVVRTEYVYTRPPP |
Rabbit Polyclonal Anti-EXT2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EXT2 antibody: synthetic peptide directed towards the N terminal of human EXT2. Synthetic peptide located within the following region: NELLMAISDSDYYTDDINRACLFVPSIDVLNQNTLRIKETAQAMAQLSRW |
Rabbit Polyclonal Anti-HS6ST2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-HS6ST2 Antibody is: synthetic peptide directed towards the C-terminal region of Human HS6ST2. Synthetic peptide located within the following region: QNPNPNANQNLTQNLMQNLTQSLSQKENRESPKQNSGKEQNDNTSNGTND |
Rabbit Polyclonal Anti-XYLT1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-XYLT1 antibody: synthetic peptide directed towards the middle region of human XYLT1. Synthetic peptide located within the following region: RITNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFHRFQQTARPTFFARKF |
Rabbit Polyclonal Anti-NDST4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NDST4 antibody: synthetic peptide directed towards the N terminal of human NDST4. Synthetic peptide located within the following region: EDWTIFQYNHSTYQPVLLTELQTEKSLSSLSSKTLFATVIQDLGLHDGIQ |
Rabbit Polyclonal Anti-NDST4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NDST4 antibody: synthetic peptide directed towards the middle region of human NDST4. Synthetic peptide located within the following region: YLFLLMHPSIISNLPSPKTFEEVQFFNGNNYHKGIDWYMDFFPTPSNTTS |
Rabbit Polyclonal Anti-HS3ST3B1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HS3ST3B1 antibody: synthetic peptide directed towards the N terminal of human HS3ST3B1. Synthetic peptide located within the following region: AMLCVWLYMFLYSCAGSCAAAPGLLLLGSGSRAAHDPPALATAPDGTPPR |
Rabbit Polyclonal Anti-NDST3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NDST3 antibody: synthetic peptide directed towards the N terminal of human NDST3. Synthetic peptide located within the following region: PGTDWTVFQINHSAYQPVIFAKVKTPENLSPSISKGAFYATIIHDLGLHD |
Rabbit Polyclonal Anti-B3GAT3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-B3GAT3 antibody: synthetic peptide directed towards the N terminal of human B3GAT3. Synthetic peptide located within the following region: PPLRAAAEQLRQKDLRISQLQAELRRPPPAPAQPPEPEALPTIYVVTPTY |
Rabbit Polyclonal Anti-B3GALT6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-B3GALT6 antibody: synthetic peptide directed towards the N terminal of human B3GALT6. Synthetic peptide located within the following region: EREQARHGDLLLLPALRDAYENLTAKVLAMLAWLDEHVAFEFVLKADDDS |
Rabbit Polyclonal Anti-B3GALT6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-B3GALT6 antibody: synthetic peptide directed towards the C terminal of human B3GALT6. Synthetic peptide located within the following region: VQREHDPRFDTEYRSRGCSNQYLVTHKQSLEDMLEKHATLAREGRLCKRE |
HS6ST1 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |