Products

View as table Download

Progesterone Receptor (PGR) mouse monoclonal antibody, Purified

Applications IF, IHC, IP, WB
Reactivities Human, Monkey, Mouse, Rat

Rabbit polyclonal antibody to Progesterone receptor (progesterone receptor)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 18 and 112 of Progesterone Receptor (Uniprot ID#P06401)

Rabbit Polyclonal Progesterone Receptor Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Progesterone Receptor

Rabbit Polyclonal Progesterone Receptor (Ser294) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Progesterone Receptor around the phosphorylation site of Serine 294
Modifications Phospho-specific

Rabbit Polyclonal Progesterone Receptor (Ser400) Antibody (Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Progesterone Receptor around the phosphorylation site of Serine 400
Modifications Phospho-specific

Progesterone Receptor (PGR) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 348-377 amino acids from the Central region of human Progesterone receptor

Rabbit polyclonal PGR/PR Antibody (C-term)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PGR/PR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 816-843 amino acids from the C-terminal region of human PGR/PR.

Rabbit anti Progesterone Receptor (PR) Polyclonal Antibody

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to C-terminus of human Progesterone receptor. This sequence is identical within human, mouse, rat, chicken, bovine and dog origins.

mouse Anti-Progesterone Receptor (Ser190) Antibody (Phospho-Specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Modifications Phospho-specific

mouse Anti-Progesterone Receptor (Ser294) Antibody (Phospho-Specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Modifications Phospho-specific

Rabbit Polyclonal anti-PR Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for Anti-PR antibody is: synthetic peptide directed towards the N-terminal region of Human PR. Synthetic peptide located within the following region: LPRGLSPARQLLLPASESPHWSGAPVKPSPQAAAVEVEEEDGSESEESAG

Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody,clone OTI1B3

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI11G9 (formerly 11G9)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI1F8 (formerly 1F8)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI4B3 (formerly 4B3)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI15C1 (formerly 15C1)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI11E8 (formerly 11E8)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI5E8 (formerly 5E8)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI7A9 (formerly 7A9)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI20A11 (formerly 20A11)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI24A2 (formerly 24A2)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI34G6 (formerly 34G6)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI31D9 (formerly 31D9)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI4A11 (formerly 4A11)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Pgr Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse Pgr

Progesterone Receptor Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human Progesterone Receptor (NP_000917.3).
Modifications Unmodified

Progesterone Receptor Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 830 to the C-terminus of human Progesterone Receptor (NP_000917.3).
Modifications Unmodified

PGR (Progesterone Receptor) mouse monoclonal antibody, clone OTI11G9 (formerly 11G9)

Applications WB
Reactivities Human
Conjugation Unconjugated