Germany
Japan
United Kingdom
China
Products
Rabbit anti-BIRC7 Polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human BIRC7 |
Rabbit Polyclonal Livin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Livin antibody was raised with a synthetic peptide corresponding to amino acids 264 to 280 of the short form and 281 to 298 of the long form of human Livin (1,3) This sequence is identical between a and b forms of the Livin proteins . |
Livin (BIRC7) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
Rabbit Polyclonal Anti-BIRC7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BIRC7 antibody: synthetic peptide directed towards the middle region of human BIRC7. Synthetic peptide located within the following region: EERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFL |
Mouse Monoclonal Livin Antibody (88C570)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-BIRC7 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
BIRC7 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-265 of human BIRC7 (NP_647478.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Category
-
- Antibodies
-
-
-
-
Target Symbol
- BIRC7