Products

cDNA Clones (35)
RNAi (12)
Antibodies (10)
Proteins (10)
Gene Expression (8)
Jump to Filters
View as table Download
CHRNA1 Rabbit Polyclonal Antibody
TA332599

USD 275.00

3 Weeks

Rabbit anti-CHRNA1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CHRNA1
CHRNA1 Rabbit Polyclonal Antibody
AP23320PU-N

USD 405.00

2 Weeks

CHRNA1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence at the N-terminal of Human CHRNA1, identical to the related Rat and Mouse sequence
Chrna1 Rabbit Polyclonal Antibody
TA328881

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-Nicotinic Acetylcholine Receptor alpha1 (extracellular)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide EHETRLVAKLFKD(C), corresponding to amino acid residues 22-34 of rat nAChRa1. Extracellular, N-terminus.
CHRNA1 Rabbit Polyclonal Antibody
TA330009

USD 375.00

5 Days

Rabbit Polyclonal Anti-CHRNA1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRNA1 antibody: synthetic peptide directed towards the C terminal of human CHRNA1. Synthetic peptide located within the following region: STHVMPNWVRKVFIDTIPNIMFFSTMKRPSREKQDKKIFTEDIDISDISG
CHRNA1 Rabbit Polyclonal Antibody
TA338392

USD 375.00

5 Days

Rabbit Polyclonal Anti-CHRNA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRNA1 antibody: synthetic peptide directed towards the N terminal of human CHRNA1. Synthetic peptide located within the following region: TRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNV
CHRNA1 Rabbit Polyclonal Antibody
TA338393

USD 375.00

5 Days

Rabbit Polyclonal Anti-CHRNA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRNA1 antibody: synthetic peptide directed towards the N terminal of human CHRNA1. Synthetic peptide located within the following region: AGLVLGSEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVD
CHRNA1 Rabbit Polyclonal Antibody
TA350717

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-CHRNA1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CHRNA1
CHRNA1 Rabbit Polyclonal Antibody
TA371138

USD 380.00

4 Weeks

CHRNA1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CHRNA1
CHRNA1 Rabbit Polyclonal Antibody
TA383999

USD 380.00

4 Weeks

AChR alpha1 Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from the Internal region of human CHRNA1. AA range:171-220
CHRNA1 Rat Monoclonal Antibody [Clone ID: mAb 192]
TA385950

USD 523.00

2 Weeks

Recombinant Anti-Human Muscle Acetylcholine Receptor (Clone mAb 192)

Applications Bl, ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated