Products

View as table Download

Rabbit Polyclonal Anti-TPM1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TPM1 antibody: synthetic peptide directed towards the N terminal of human TPM1. Synthetic peptide located within the following region: DRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQE

TPM1 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat, Zebrafish
Conjugation Unconjugated
Immunogen Recombinant protein of human TPM1

Rabbit Polyclonal Anti-TPM1 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TPM1 antibody: synthetic peptide directed towards the middle region of human TPM1. Synthetic peptide located within the following region: LKEAETRAEFAERSVTKLEKSIDDLEDQLYQQLEQNRRLTNELKLALNED

TPM1 (Sarcomeric) mouse monoclonal antibody, clone ST-39, Purified

Applications IF, IHC, IP, WB
Reactivities Chicken, Human, Rabbit, Rat

TPM1 (36Da) mouse monoclonal antibody, clone TM-36, Purified

Applications IF, IHC, WB
Reactivities Chicken, Human, Mouse, Rat

TPM1 (92-283) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 92 - 283 of Human Tropomyosin 1

TPM1 (36/39kDa) mouse monoclonal antibody, clone TM-33, Purified

Applications WB
Reactivities Chicken, Human, Mouse, Rat

Anti-TPM1 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Anti-TPM1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

TPM1 Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human TPM1

Tropomyosin-1 alpha phospho S283 Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Tropomyosin-1 alpha pS283 affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide surrounding S283 human Tropomyosin-1 alpha pS283.