Germany
Japan
United Kingdom
China
CBS (Myc-DDK-tagged)-Human cystathionine-beta-synthase (CBS), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
MAT2A (Myc-DDK-tagged)-Human methionine adenosyltransferase II, alpha (MAT2A)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
CTH (Myc-DDK-tagged)-Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
CTH (Myc-DDK-tagged)-Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
METTL2B (Myc-DDK-tagged)-Human methyltransferase like 2B (METTL2B)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
MARS2 (Myc-DDK-tagged)-Human methionyl-tRNA synthetase 2, mitochondrial (MARS2), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
MARS (Myc-DDK-tagged)-Human methionyl-tRNA synthetase (MARS)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
WBSCR22 (Myc-DDK-tagged)-Human Williams Beuren syndrome chromosome region 22 (WBSCR22), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
MAT1A (untagged)-Human methionine adenosyltransferase I, alpha (MAT1A)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit anti-AHCY Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AHCY |
MAT2A (untagged)-Human methionine adenosyltransferase II, alpha (MAT2A)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
MARS (untagged)-Human methionyl-tRNA synthetase (MARS)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
LCMT1 (untagged)-Human leucine carboxyl methyltransferase 1 (LCMT1), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
MAT2B (untagged)-Human methionine adenosyltransferase II, beta (MAT2B), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-CBS Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS. Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE |
Active filters
Pathways
- Selenoamino acid metabolism
Citations
- Yes