Rabbit polyclonal Cytochrome P450 8B1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 8B1. |
Rabbit polyclonal Cytochrome P450 8B1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 8B1. |
Rabbit polyclonal anti-SLC27A5 antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SLC27A5. |
CYP39A1 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide from Human Cytochrome P450 39A1. |
Rabbit polyclonal Cytochrome P450 39A1 antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 39A1. |
Rabbit Polyclonal Anti-SLC27A5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SLC27A5 antibody: synthetic peptide directed towards the middle region of human SLC27A5. Synthetic peptide located within the following region: KLYQHVRAWLPAYATPHFIRIQDAMEVTSTFKLMKTRLVREGFNVGIVVD |
Rabbit polyclonal Cytochrome P450 7B1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 7B1. |
Rabbit polyclonal anti-CYP39A1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human CYP39A1. |
Rabbit polyclonal CYP8B1 Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CYP8B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 471-501 amino acids from the C-terminal region of human CYP8B1. |
Rabbit Polyclonal Anti-CH25H Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CH25H antibody is: synthetic peptide directed towards the C-terminal region of Human CH25H. Synthetic peptide located within the following region: VTLLGCHPLTTLTFHVVNIWLSVEDHSGYNFPWSTHRLVPFGWYGGVVHH |
CYP7B1 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
CYP7B1 (C-term) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC |
Reactivities | Bovine, Human |
Immunogen | Peptide with sequence C-YPDSDVLFRYKVKS, from the C Terminus of the protein sequence according to NP_004811.1. |
Rabbit Polyclonal Anti-CYP7B1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP7B1 antibody: synthetic peptide directed towards the C terminal of human CYP7B1. Synthetic peptide located within the following region: AMYYLLRHPEAMAAVRDEIDRLLQSTGQKKGSGFPIHLTREQLDSLICLE |
CYP7B1 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human CYP7B1 |
Rabbit Polyclonal Anti-HSD3B7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HSD3B7 antibody: synthetic peptide directed towards the middle region of human HSD3B7. Synthetic peptide located within the following region: QGTRNVIEACVQTGTRFLVYTSSMEVVGPNTKGHPFYRGNEDTPYEAVHR |
Rabbit Polyclonal Anti-CYP8B1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP8B1 antibody: synthetic peptide directed towards the middle region of human CYP8B1. Synthetic peptide located within the following region: SLLWPREWLEVGRLQRLFHKMLSVSHSQEKEGISNWLGNMLQFLREQGVP |
Rabbit Polyclonal Anti-CYP39A1 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CYP39A1 |
Rabbit Polyclonal Anti-HSD3B7 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HSD3B7 |
Rabbit Polyclonal Anti-CYP7A1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CYP7A1 |
Rabbit Polyclonal Anti-SLC27A5 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLC27A5 |