Products

Jump to Filters
View as table Download
Syntaxin 1a (STX1A) Rabbit Polyclonal Antibody
TA341216

USD 425.00

5 Days

Rabbit Polyclonal Anti-STX1A Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen STX1A / Syntaxin 1A antibody was raised against synthetic 16 amino acid peptide from internal region of human STX1A / Syntaxin 1A. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Pig, Opossum, Turkey, Chicken (100%); Horse, Xenopus (94%); Gibbon, Sheep, Zebra finch, Salmon, Stickleback, Pufferfish, Zebrafish, Ant, Water flea (88%); Beetle (81%).
VAMP5 Rabbit Polyclonal Antibody
TA341852

USD 310.00

5 Days

Rabbit Polyclonal Anti-VAMP5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VAMP5 antibody: synthetic peptide directed towards the middle region of human VAMP5. Synthetic peptide located within the following region: IRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN
SYBL1 (VAMP7) Rabbit Polyclonal Antibody
TA342435

USD 375.00

5 Days

Rabbit Polyclonal Anti-VAMP7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VAMP7 antibody: synthetic peptide directed towards the N terminal of human VAMP7. Synthetic peptide located within the following region: KIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFNFLNEIKK
GOSR1 Rabbit Polyclonal Antibody
TA342639

USD 375.00

5 Days

Rabbit Polyclonal Anti-GOSR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GOSR1 antibody: synthetic peptide directed towards the C terminal of human GOSR1. Synthetic peptide located within the following region: IHSKMNTLANRFPAVNSLIQRINLRKRRDSLILGGVIGICTILLLLYAFH
SNAP29 Rabbit Polyclonal Antibody
TA342640

USD 375.00

5 Days

Rabbit Polyclonal Anti-SNAP29 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Snap29 antibody is: synthetic peptide directed towards the middle region of Rat Snap29. Synthetic peptide located within the following region: QPSSRLKEAINTSKDQESKYQASHPNLRRLHDAELDSVPASTVNTEVYPK
SNAP29 Rabbit Polyclonal Antibody
TA342641

USD 375.00

5 Days

Rabbit Polyclonal Anti-SNAP29 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SNAP29 antibody: synthetic peptide directed towards the middle region of human SNAP29. Synthetic peptide located within the following region: QPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYP
Syntaxin 4 (STX4) Rabbit Polyclonal Antibody
TA342642

USD 375.00

5 Days

Rabbit Polyclonal Anti-STX4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STX4 antibody: synthetic peptide directed towards the C terminal of human STX4. Synthetic peptide located within the following region: VEMQGEMINRIEKNILSSADYVERGQEHVKTALENQKKARKKKVLIAICV
Syntaxin 4 (STX4) Rabbit Polyclonal Antibody
TA342643

USD 375.00

5 Days

Rabbit Polyclonal Anti-STX4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STX4 antibody: synthetic peptide directed towards the middle region of human STX4. Synthetic peptide located within the following region: LKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELINKCNSMQSEYRE
VAMP8 Rabbit Polyclonal Antibody
TA342644

USD 375.00

5 Days

Rabbit Polyclonal Anti-VAMP8 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Vamp8 antibody is: synthetic peptide directed towards the middle region of Rat Vamp8. Synthetic peptide located within the following region: LDHLRNKTEDLEATSEHFKTTSQKVARKFWWKNVKMIVIICVIVLIILIL
Syntaxin 7 (STX7) Rabbit Polyclonal Antibody
TA343113

USD 375.00

5 Days

Rabbit Polyclonal Anti-STX7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STX7 antibody: synthetic peptide directed towards the N terminal of human STX7. Synthetic peptide located within the following region: PSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKEFVARVRASSRVS
Syntaxin 8 (STX8) Rabbit Polyclonal Antibody
TA343114

USD 375.00

5 Days

Rabbit Polyclonal Anti-STX8 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Stx8 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Stx8. Synthetic peptide located within the following region: IISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLRTEARRVTLVDRK
VAMP1 Rabbit Polyclonal Antibody
TA343286

USD 375.00

5 Days

Rabbit Polyclonal Anti-VAMP1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Vamp1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Vamp1. Synthetic peptide located within the following region: MSAPAQPPAEGTEGAAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIMRV
BNIP1 Rabbit Polyclonal Antibody
TA321303

USD 345.00

In Stock

Anti-BNIP1 rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 4-227 amino acids of human BCL2/adenovirus E1B 19kDa interacting protein 1
BNIP1 Rabbit Polyclonal Antibody
TA321304

USD 345.00

In Stock

Anti-BNIP1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 4-227 amino acids of human BCL2/adenovirus E1B 19kDa interacting protein 1
Syntaxin 1a (STX1A) Rabbit Polyclonal Antibody
TA322721

USD 345.00

In Stock

Anti-STX1A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1-15 amino acids of human syntaxin 1A (brain)
Syntaxin 1a (STX1A) Rabbit Polyclonal Antibody
TA322722

USD 345.00

In Stock

Anti-STX1A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1-15 amino acids of human syntaxin 1A (brain)
SNAP25 Rabbit Polyclonal Antibody
TA322907

USD 345.00

In Stock

Anti-SNAP25 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
SNAP25 Rabbit Polyclonal Antibody
TA322908

USD 345.00

In Stock

Anti-SNAP25 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
SNAP23 Rabbit Polyclonal Antibody
TA350431

USD 345.00

In Stock

Rabbit Polyclonal Anti-SNAP23 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SNAP23
SNAP29 Rabbit Polyclonal Antibody
TA350432

USD 345.00

In Stock

Rabbit Polyclonal Anti-SNAP29 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SNAP29
Syntaxin 7 (STX7) Rabbit Polyclonal Antibody
TA350469

USD 345.00

In Stock

Rabbit Polyclonal Anti-STX7 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human STX7
Syntaxin 8 (STX8) Rabbit Polyclonal Antibody
TA350470

USD 345.00

In Stock

Rabbit Polyclonal Anti-STX8 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human STX8
Syntaxin 12 (STX12) Rabbit Polyclonal Antibody
TA350471

USD 345.00

In Stock

Rabbit Polyclonal Anti-STX12 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
Syntaxin 16 (STX16) Rabbit Polyclonal Antibody
TA350472

USD 345.00

In Stock

Rabbit Polyclonal Anti-STX16 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human STX16
Syntaxin 18 (STX18) Rabbit Polyclonal Antibody
TA350473

USD 345.00

In Stock

Rabbit Polyclonal Anti-STX18 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human STX18
STX10 Rabbit Polyclonal Antibody
TA350475

USD 345.00

In Stock

Rabbit Polyclonal Anti-STX10 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human STX10
STX11 Rabbit Polyclonal Antibody
TA350476

USD 345.00

In Stock

Rabbit Polyclonal Anti-STX11 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human STX11
STX19 Rabbit Polyclonal Antibody
TA350477

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-STX19 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein
VAMP4 Rabbit Polyclonal Antibody
TA350594

USD 345.00

In Stock

Rabbit Polyclonal Anti-VAMP4 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein
VAMP5 Rabbit Polyclonal Antibody
TA350595

USD 345.00

In Stock

Rabbit Polyclonal Anti-VAMP5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Full length fusion protein
Syntaxin 3 (STX3) Rabbit Polyclonal Antibody
TA351776

USD 345.00

In Stock

Rabbit Polyclonal Anti-STX3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human STX3
VAMP1 Rabbit Polyclonal Antibody
TA351909

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-VAMP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human VAMP1
VAMP2 Rabbit Polyclonal Antibody
TA351910

USD 345.00

In Stock

Rabbit Polyclonal Anti-VAMP2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human VAMP2
Syntaxin 8 (STX8) Rabbit Polyclonal Antibody
TA357797

USD 360.00

5 Days

STX8 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Syntaxin 2 (STX2) Rabbit Polyclonal Antibody
TA357811

USD 360.00

5 Days

STX2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
VTI1B Rabbit Polyclonal Antibody
TA357951

USD 360.00

5 Days

VTI1B Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
STX11 Rabbit Polyclonal Antibody
TA357984

USD 360.00

5 Days

STX11 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Membrin (GOSR2) Rabbit Polyclonal Antibody
TA358040

USD 360.00

5 Days

GOSR2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Syntaxin 16 (STX16) Rabbit Polyclonal Antibody
TA358740

USD 360.00

5 Days

STX16 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated