Products

View as table Download

Rabbit Polyclonal Anti-CD253 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD253 Antibody: A synthesized peptide derived from human CD253

Rabbit Polyclonal Trail Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TRAIL antibody was raised against a peptide corresponding to 17 amino acids near the carboxy terminus of human TRAIL. The immunogen is located within the last 50 amino acids of Trail.

Rabbit polyclonal anti-CD253 / TNFSF10 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CD253.

Tnfsf10 rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Mouse
Conjugation Biotin
Immunogen Highly pure (>98%) recombinant Human soluble TRAIL Receptor-2.

Tnfsf10 rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Mouse
Conjugation Biotin
Immunogen Highly pure (>98%) recombinant Human soluble TRAIL Receptor-2.

Tnfsf10 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Mouse
Immunogen Highly pure recombinant Murine TRAIL.

Tnfsf10 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Mouse
Immunogen Highly pure recombinant Murine TRAIL.

Rabbit anti CD253/TRAIL/ (TNFSF10) (IN1) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the N-terminus of TRAIL protein (from 115aa-140aa). This sequence is identical to human and mouse.

Anti-Human sTRAIL/Apo2L Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human sTRAIL/Apo2L

Rabbit Polyclonal Anti-TNFSF10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNFSF10 antibody: synthetic peptide directed towards the N terminal of human TNFSF10. Synthetic peptide located within the following region: CFLKEDDSYWDPNDEESMNSPCWQVKWQLRQLVRKMILRTSEETISTVQE

Rabbit anti CD253/TRAIL (IN2) Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the internal sequence of human TRAIL protein (from 160aa-190aa). This sequence is has one amino acid difference from rat origin.

Rabbit anti CD253/TRAIL (CT) Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the C-terminus of TRAIL protein (from 230aa-280aa). This sequence is identical to human, rat and mouse.

TNFSF10 rabbit polyclonal antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TNFSF10

TNFSF10 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TNFSF10

TNFSF10 Rabbit polyclonal Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TNFSF10 (NP_003801.1).
Modifications Unmodified

TNFSF10 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TNFSF10 (NP_003801.1).
Modifications Unmodified

TNFSF10 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 39-250 of human TNFSF10 (NP_003801.1).
Modifications Unmodified