Germany
Japan
United Kingdom
China
Rabbit anti-RAD17 Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human RAD17 |
Products
View as table Download
Rabbit Polyclonal Anti-RAD17 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAD17 Antibody: A synthesized peptide derived from human RAD17 |
Rabbit Polyclonal anti-RAD17 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAD17 antibody: synthetic peptide directed towards the C terminal of human RAD17. Synthetic peptide located within the following region: PTQATVPETWSLPLSQNSASELPASQPQPFSAQGDMEENIIIEDYESDGT |
Rabbit Polyclonal anti-RAD17 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAD17 antibody: synthetic peptide directed towards the N terminal of human RAD17. Synthetic peptide located within the following region: MNQVTDWVDPSFDDFLECSGVSTITATSLGVNNSSHRRKNGPSTLESSRF |
Rabbit Polyclonal Rad17 Antibody
| Applications | WB |
| Reactivities | Yeast |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to Schizosaccharomyces pombe RAD17. |
Rabbit Polyclonal Rad17 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to a N-terminal region of human RAD17. |
Rabbit Polyclonal Anti-RAD17 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RAD17 |
RAD17 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RAD17 |
RAD17 Antibody - C-terminal region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human RAD17 |
RAD17 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RAD17 |
Active filters
Target Symbol
- RAD17
Conjugates
- Unconjugated