Products

View as table Download

Rabbit Polyclonal TCF3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TCF3 antibody was raised against a 17 amino acid peptide near the amino terminus of human TCF3.

Rabbit polyclonal anti-TCF3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human TCF3.

Rabbit polyclonal Transcription Factor 3 / E2A (Thr355) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human E2A around the phosphorylation site of threonine 355 (P-S-TP-P-V).
Modifications Phospho-specific

Goat Polyclonal Antibody against TCF3 / ITF1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KAPRARTSPDEDED, from the internal region of the protein sequence according to NP_003191.1.

Rabbit polyclonal anti-Transcription Factor 3 (E2A Immunoglobulin Enhancer Binding Factors E12/E47) antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human E2A.

Rabbit Polyclonal anti-Tcf3 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Tcf3 antibody is: synthetic peptide directed towards the C-terminal region of Rat Tcf3. Synthetic peptide located within the following region: ARERLRVRDINEAFKELGRMCQLHLSTEKPQTKLLILHQAVAVILSLEQQ

Rabbit Polyclonal Anti-TCF3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TCF3 antibody: synthetic peptide directed towards the C terminal of human TCF3. Synthetic peptide located within the following region: EENTSAADHSEEEKKELKAPRARTSPDEDEDDLLPPEQKAEREKERRVAN

Rabbit Polyclonal Anti-TCF3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-TCF3 antibody is: synthetic peptide directed towards the N-terminal region of Human TCF3. Synthetic peptide located within the following region: EDRPSSGSWGSGDQSSSSFDPSRTFSEGTHFTESHSSLSSSTFLGPGLGG

Rabbit Polyclonal Anti-TCF3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TCF3 antibody: synthetic peptide directed towards the N terminal of human TCF3. Synthetic peptide located within the following region: MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGL

TCF3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TCF3

TCF3 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TCF3

TCF3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TCF3
Modifications Unmodified