Germany
Japan
United Kingdom
China
SMAD6 (Myc-DDK-tagged)-Human SMAD family member 6 (SMAD6), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human SMAD family member 6 (SMAD6), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, SMAD6 (Myc-DDK tagged) - Human SMAD family member 6 (SMAD6), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, SMAD6 (mGFP-tagged) - Human SMAD family member 6 (SMAD6), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
SMAD6 (Myc-DDK-tagged)-Human SMAD family member 6 (SMAD6), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SMAD6 (GFP-tagged) - Human SMAD family member 6 (SMAD6), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of SMAD6 (Myc-DDK-tagged)-Human SMAD family member 6 (SMAD6), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SMAD6 (Myc-DDK-tagged)-Human SMAD family member 6 (SMAD6), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of SMAD6 (mGFP-tagged)-Human SMAD family member 6 (SMAD6), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SMAD6 (mGFP-tagged)-Human SMAD family member 6 (SMAD6), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human SMAD family member 6 (SMAD6), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SMAD6 (Myc-DDK tagged) - Human SMAD family member 6 (SMAD6), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human SMAD family member 6 (SMAD6), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SMAD6 (mGFP-tagged) - Human SMAD family member 6 (SMAD6), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
SMAD6 (GFP-tagged) - Human SMAD family member 6 (SMAD6), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SMAD6 (untagged)-Human SMAD family member 6 (SMAD6), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human SMAD family member 6 (SMAD6), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human SMAD family member 6 (SMAD6), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
SMAD6 (untagged)-Human SMAD family member 6 (SMAD6), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of SMAD family member 6 (SMAD6), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
SMAD6 mouse monoclonal antibody, clone 4C8
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
SMAD6 (285-385) mouse monoclonal antibody, clone 4F3, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
Rabbit Polyclonal Anti-SMAD6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SMAD6 antibody: synthetic peptide directed towards the N terminal of human SMAD6. Synthetic peptide located within the following region: APRDASDPLAGAALEPAGGGRSREARSRLLLLEQELKTVTYSLLKR |
SMAD6 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal SMAD6 Antibody (Center)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SMAD6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 358-386 amino acids from the Central region of human SMAD6. |
Rabbit Polyclonal Anti-SMAD6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SMAD6 antibody: synthetic peptide directed towards the N terminal of human SMAD6. Synthetic peptide located within the following region: GAPRDASDPLAGAALEPAGGGRSREARSRLLLLEQELKTVTYSLLKRLKE |
Rabbit Polyclonal SMAD6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Primate, Sheep |
| Conjugation | Unconjugated |
| Immunogen | This antibody was developed against 2 synthetic peptides found between amino acids 30-150 and 300-400 of human SMAD6 (GenBank Accession No. AAH12986.1). These peptide sequences are specific to SMAD6, and have high homology to SMAD6 in multiple species. |
SMAD6 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
Rabbit Polyclonal Anti-SMAD6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SMAD6 antibody is: synthetic peptide directed towards the N-terminal region of Human SMAD6. Synthetic peptide located within the following region: RRLWRSRVVPDREEGGSGGGGGGDEDGSLGSRAEPAPRAREGGGCGRSEV |
SMAD6 MS Standard C13 and N15-labeled recombinant protein (NP_001136333)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
SMAD6 (untagged)-Human SMAD family member 6 (SMAD6), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of SMAD6 (NM_005585) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SMAD6 (NM_001142861) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SMAD6 (NM_005585) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SMAD6 (NM_005585) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of SMAD6 (NM_001142861) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SMAD6 (NM_001142861) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- SMAD6
Families
- Cancer stem cells