Products

Proteins (11)
cDNA Clones (11)
Antibodies (3)
Jump to Filters
View as table Download
14 3 3 eta (YWHAH) (NM_003405) Human Tagged ORF Clone
RC200013

USD 98.00

USD 390.00

In Stock

YWHAH (Myc-DDK-tagged)-Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
14 3 3 eta (YWHAH) (NM_003405) Human Recombinant Protein
TP300013

USD 823.00

In Stock

Recombinant protein of human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH)

Tag C-Myc/DDK
Expression Host HEK293T

Special Offer: Get a 20% discount on this product. Use code: "MVPro20".

14 3 3 eta (YWHAH) (NM_003405) Human Tagged ORF Clone Lentiviral Particle
RC200013L1V

USD 1,020.00

2 Weeks

Lenti ORF particles, YWHAH (Myc-DDK tagged) - Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
14 3 3 eta (YWHAH) (NM_003405) Human Tagged ORF Clone Lentiviral Particle
RC200013L2V

USD 1,020.00

5 Weeks

Lenti ORF particles, YWHAH (mGFP-tagged) - Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
14 3 3 eta (YWHAH) (NM_003405) Human Tagged ORF Clone
RG200013

USD 460.00

In Stock

YWHAH (GFP-tagged) - Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
14 3 3 eta (YWHAH) (NM_003405) Human Tagged Lenti ORF Clone
RC200013L3

USD 768.00

3 Weeks

Lenti ORF clone of Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
14 3 3 eta (YWHAH) (NM_003405) Human Tagged ORF Clone Lentiviral Particle
RC200013L3V

USD 1,020.00

5 Weeks

Lenti ORF particles, YWHAH (Myc-DDK tagged) - Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
14 3 3 eta (YWHAH) (NM_003405) Human Tagged Lenti ORF Clone
RC200013L4

USD 768.00

In Stock

Lenti ORF clone of Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
14 3 3 eta (YWHAH) (NM_003405) Human Tagged ORF Clone Lentiviral Particle
RC200013L4V

USD 1,020.00

2 Weeks

Lenti ORF particles, YWHAH (mGFP-tagged) - Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
14 3 3 eta (YWHAH) (NM_003405) Human Tagged Lenti ORF Clone
RC200013L1

USD 768.00

In Stock

Lenti ORF clone of Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
14 3 3 eta (YWHAH) (NM_003405) Human Untagged Clone
SC126632

USD 310.00

In Stock

YWHAH (untagged)-Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
14 3 3 eta (YWHAH) Rabbit Polyclonal Antibody
TA314676

USD 345.00

In Stock

Rabbit polyclonal anti-14-3-3 eta antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human 14-3-3 ?.
14 3 3 eta (YWHAH) Rabbit Polyclonal Antibody
AP20467PU-N

USD 407.00

2 Weeks

14 3 3 eta (YWHAH) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 50-100 of Human 14-3-3 η.
14 3 3 eta (YWHAH) (NM_003405) Human Tagged Lenti ORF Clone
RC200013L2

USD 768.00

3 Weeks

Lenti ORF clone of Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
14 3 3 eta (YWHAH) (NM_003405) Human Over-expression Lysate
LC418678

USD 121.00

In Stock

YWHAH HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
14 3 3 eta (YWHAH) Rabbit Polyclonal Antibody
TA330344

USD 375.00

5 Days

Rabbit Polyclonal Anti-YWHAH Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-YWHAH antibody: synthetic peptide directed towards the N terminal of human YWHAH. Synthetic peptide located within the following region: ADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKV
14-3-3 protein eta (1-246, His-tag) Human Protein
AR09102PU-L

USD 845.00

2 Weeks

14-3-3 protein eta (1-246, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
14-3-3 protein eta (1-246, His-tag) Human Protein
AR09102PU-N

USD 330.00

2 Weeks

14-3-3 protein eta (1-246, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
14-3-3 protein eta (1-246) Human Protein
AR52074PU-N

USD 845.00

2 Weeks

14-3-3 protein eta (1-246) human protein, 0.5 mg

Expression Host E. coli
14-3-3 protein eta (1-246) Human Protein
AR52074PU-S

USD 330.00

2 Weeks

14-3-3 protein eta (1-246) human protein, 0.1 mg

Expression Host E. coli
14 3 3 eta (YWHAH) (NM_003405) Human Over-expression Lysate
LY418678

USD 396.00

5 Days

Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
14 3 3 eta (YWHAH) (NM_003405) Human Mass Spec Standard
PH300013

USD 2,055.00

3 Weeks

YWHAH MS Standard C13 and N15-labeled recombinant protein (NP_003396)

Tag C-Myc/DDK
Expression Host HEK293
14 3 3 eta (YWHAH) ICC Control Block
TB400013

USD 1,040.00

4 Weeks

Transient overexpression of YWHAH (NM_003405) in HEK293T cells paraffin embedded controls for ICC/IHC staining

14 3 3 eta (YWHAH) Cytosection
TS400013

USD 225.00

4 Weeks

Transient overexpression of YWHAH (NM_003405) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

14 3 3 eta (YWHAH) Cytosection
TS400013P5

USD 889.00

4 Weeks

Transient overexpression of YWHAH (NM_003405) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack