Products

cDNA Clones (18)
Proteins (13)
Antibodies (6)
Jump to Filters
View as table Download
CES2 (NM_003869) Human Tagged ORF Clone
RC203009

USD 420.00

In Stock

CES2 (Myc-DDK-tagged)-Human carboxylesterase 2 (CES2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CES2 (NM_198061) Human Tagged ORF Clone
RC223021

USD 480.00

In Stock

CES2 (Myc-DDK-tagged)-Human carboxylesterase 2 (CES2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CES2 (NM_003869) Human Tagged ORF Clone Lentiviral Particle
RC203009L1V

USD 820.00

3 Weeks

Lenti ORF particles, CES2 (Myc-DDK tagged) - Human carboxylesterase 2 (CES2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
CES2 (NM_003869) Human Tagged ORF Clone Lentiviral Particle
RC203009L2V

USD 820.00

6 Weeks

Lenti ORF particles, CES2 (mGFP-tagged) - Human carboxylesterase 2 (CES2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
CES2 (NM_003869) Human Untagged Clone
SC128182

USD 310.00

In Stock

CES2 (untagged)-Human carboxylesterase 2 (CES2), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CES2 (NM_003869) Human Tagged ORF Clone
RG203009

USD 460.00

In Stock

CES2 (GFP-tagged) - Human carboxylesterase 2 (CES2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CES2 (NM_003869) Human Tagged ORF Clone
RC203009L3

USD 620.00

3 Weeks

Lenti ORF clone of Human carboxylesterase 2 (CES2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CES2 (NM_003869) Human Tagged ORF Clone Lentiviral Particle
RC203009L3V

USD 820.00

5 Weeks

Lenti ORF particles, CES2 (Myc-DDK tagged) - Human carboxylesterase 2 (CES2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CES2 (NM_003869) Human Tagged ORF Clone
RC203009L4

USD 620.00

3 Weeks

Lenti ORF clone of Human carboxylesterase 2 (CES2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CES2 (NM_003869) Human Tagged ORF Clone Lentiviral Particle
RC203009L4V

USD 820.00

7 Weeks

Lenti ORF particles, CES2 (mGFP-tagged) - Human carboxylesterase 2 (CES2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CES2 (NM_198061) Human Tagged ORF Clone
RC223021L3

USD 680.00

3 Weeks

Lenti ORF clone of Human carboxylesterase 2 (CES2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CES2 (NM_198061) Human Tagged ORF Clone Lentiviral Particle
RC223021L3V

USD 880.00

6 Weeks

Lenti ORF particles, CES2 (Myc-DDK tagged) - Human carboxylesterase 2 (CES2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CES2 (NM_198061) Human Tagged ORF Clone
RC223021L4

USD 680.00

3 Weeks

Lenti ORF clone of Human carboxylesterase 2 (CES2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CES2 (NM_198061) Human Tagged ORF Clone Lentiviral Particle
RC223021L4V

USD 880.00

6 Weeks

Lenti ORF particles, CES2 (mGFP-tagged) - Human carboxylesterase 2 (CES2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CES2 (NM_198061) Human Tagged ORF Clone
RG223021

USD 530.00

3 Weeks

CES2 (GFP-tagged) - Human carboxylesterase 2 (CES2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CES2 Rabbit Polyclonal Antibody
TA346369

USD 475.00

5 Days

Rabbit Polyclonal Anti-CES2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CES2 antibody: synthetic peptide directed towards the C terminal of human CES2. Synthetic peptide located within the following region: HWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKIQELEEPEERH
CES2 Rabbit Polyclonal Antibody
TA327057

USD 275.00

3 Weeks

Rabbit anti-CES2 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human CES2
CES2 Rabbit Polyclonal Antibody
TA321606

USD 345.00

In Stock

Anti-CES2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 355-369 amino acids of human carboxylesterase 2
CES2 (NM_003869) Human Over-expression Lysate
LY401274

USD 396.00

In Stock

Transient overexpression lysate of carboxylesterase 2 (intestine, liver) (CES2), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CES2 (NM_003869) Human Tagged ORF Clone
RC203009L1

USD 620.00

In Stock

Lenti ORF clone of Human carboxylesterase 2 (CES2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CES2 (NM_003869) Human Over-expression Lysate
LC401274

USD 121.00

In Stock

CES2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
CES2 (Center) Rabbit Polyclonal Antibody
AP50867PU-N

USD 450.00

2 Weeks

CES2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 343-373 amino acids from the Central region of human CES2
CES2 (NM_003869) Human Tagged ORF Clone
RC203009L2

USD 620.00

3 Weeks

Lenti ORF clone of Human carboxylesterase 2 (CES2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CES2 (NM_198061) Human Over-expression Lysate
LY405086

USD 605.00

In Stock

Transient overexpression lysate of carboxylesterase 2 (intestine, liver) (CES2), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CES2 Rabbit Polyclonal Antibody
TA314814

USD 345.00

4 Weeks

Rabbit polyclonal anti-CES2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human CES2.
CES2 Rabbit Polyclonal Antibody
TA329519

USD 375.00

5 Days

Rabbit Polyclonal anti-CES2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CES2 antibody: synthetic peptide directed towards the middle region of human CES2. Synthetic peptide located within the following region: QHQPSWLKNIRPPHMKADHVKFTEEEEQLSRKMMKYWANFARNGNPNGEG
CES2 (NM_198061) Human Over-expression Lysate
LC405086

USD 187.00

2 Weeks

CES2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CES2 (NM_003869) Human Mass Spec Standard
PH303009

USD 2,055.00

3 Weeks

CES2 MS Standard C13 and N15-labeled recombinant protein (NP_003860)

Tag C-Myc/DDK
Expression Host HEK293
CES2 (NM_198061) Human Mass Spec Standard
PH323021

USD 2,055.00

3 Weeks

CES2 MS Standard C13 and N15-labeled recombinant protein (NP_932327)

Tag C-Myc/DDK
Expression Host HEK293
CES2 (NM_198061) Human Untagged Clone
SC310219

USD 1,030.00

3 Weeks

CES2 (untagged)-Human carboxylesterase 2 (CES2), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
SC310219 is the updated version of SC127183.
CES2 (NM_003869) ICC Control Block
TB403009

USD 1,070.00

4 Weeks

Transient overexpression of CES2 (NM_003869) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CES2 (NM_198061) ICC Control Block
TB423021

USD 1,130.00

4 Weeks

Transient overexpression of CES2 (NM_198061) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CES2 Cytosection
TS403009

USD 225.00

4 Weeks

Transient overexpression of CES2 (NM_003869) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CES2 Cytosection
TS403009P5

USD 889.00

4 Weeks

Transient overexpression of CES2 (NM_003869) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CES2 Cytosection
TS423021

USD 225.00

4 Weeks

Transient overexpression of CES2 (NM_198061) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CES2 Cytosection
TS423021P5

USD 889.00

4 Weeks

Transient overexpression of CES2 (NM_198061) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack