Germany
Japan
United Kingdom
China
Lenti ORF particles, GRK5 (mGFP-tagged) - Human G protein-coupled receptor kinase 5 (GRK5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Products
View as table Download
GRK5 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase 5 (GRK5)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
GRK5 (untagged)-Human G protein-coupled receptor kinase 5 (GRK5)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Recombinant protein of human G protein-coupled receptor kinase 5 (GRK5)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, GRK5 (Myc-DDK tagged) - Human G protein-coupled receptor kinase 5 (GRK5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, GRK5 (mGFP-tagged) - Human G protein-coupled receptor kinase 5 (GRK5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
GRK5 (GFP-tagged) - Human G protein-coupled receptor kinase 5 (GRK5)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human G protein-coupled receptor kinase 5 (GRK5), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GRK5 (Myc-DDK tagged) - Human G protein-coupled receptor kinase 5 (GRK5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GRK5 Mutant (Q41L), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 5 (GRK5) as transfection-ready DNA
| Mutation | Q41L |
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human G protein-coupled receptor kinase 5 (GRK5), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human G protein-coupled receptor kinase 5 (GRK5), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human G protein-coupled receptor kinase 5 (GRK5), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
GRK5 (untagged)-Kinase deficient mutant (K215M) of Human G protein-coupled receptor kinase 5 (GRK5)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal anti-GRK5 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GRK5. |
GRK5 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Rabbit polyclonal GRK5 Antibody (C-term)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This GRK5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 559-590 amino acids from the C-terminal region of human GRK5. |
Transient overexpression lysate of G protein-coupled receptor kinase 5 (GRK5)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
GRK5 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Orang-Utan |
| Immunogen | GRK5 antibody was raised against synthetic 15 amino acid peptide from internal region of human GRK5. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon (100%); Marmoset, Mouse, Rat, Panda, Dog, Bat, Horse (93%); Elephant, Bovine, Pig (87%). |
GRK5 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Gorilla, Human |
| Immunogen | GRK5 antibody was raised against synthetic 12 amino acid peptide from near N-terminus of human GRK5. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Dog, Bovine (100%); Mouse, Rat, Pig (92%); Opossum, Chicken (83%). |
GRK5 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Chicken, Horse, Human, Monkey, Mouse, Pig, Rat |
| Immunogen | GRK5 antibody was raised against synthetic 15 amino acid peptide from internal region of human GRK5. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rat, Bat, Bovine, Panda, Horse, Pig, Opossum, Turkey, Chicken, Platypus (100%); Orangutan, Dog, Elephant, Xenopus (93%). |
Rabbit Polyclonal Anti-GRK5 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRK5 antibody: synthetic peptide directed towards the middle region of human GRK5. Synthetic peptide located within the following region: FYAAEILCGLEDLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEG |
Rabbit Polyclonal Anti-GRK5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRK5 antibody is: synthetic peptide directed towards the C-terminal region of Human GRK5. Synthetic peptide located within the following region: WGLGCLIYEMIEGQSPFRGRKEKVKREEVDRRVLETEEVYSHKFSEEAKS |
GRK5 MS Standard C13 and N15-labeled recombinant protein (NP_005299)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of GRK5 (NM_005308) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GRK5 (NM_005308) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GRK5 (NM_005308) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- GRK5
Families
- Druggable Genome
Pathways
- Endocytosis