RAB5A (Myc-DDK-tagged)-Human RAB5A, member RAS oncogene family (RAB5A)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RAB5A (Myc-DDK-tagged)-Human RAB5A, member RAS oncogene family (RAB5A)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RAB5A (GFP-tagged) - Human RAB5A, member RAS oncogene family (RAB5A)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human RAB5A, member RAS oncogene family (RAB5A)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, RAB5A (Myc-DDK tagged) - Human RAB5A, member RAS oncogene family (RAB5A), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, RAB5A (mGFP-tagged) - Human RAB5A, member RAS oncogene family (RAB5A), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF clone of Human RAB5A, member RAS oncogene family (RAB5A), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human RAB5A, member RAS oncogene family (RAB5A), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
RAB5A (myc-DDK-tagged) - Human RAB5A, member RAS oncogene family (RAB5A), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Goat Polyclonal Anti-Rab5a Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 115 aa to the C-terminus of mouse Rab5a produced in E. coli. |
RAB5A (untagged)-Human RAB5A, member RAS oncogene family (RAB5A)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Goat Polyclonal Anti-Rab5 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 115 aa to the C-terminus of mouse Rab5a, Rab5b and rab5c produced in E. coli. |
Lenti ORF clone of Human RAB5A, member RAS oncogene family (RAB5A), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit anti-RAB5A Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RAB5A |
RAB5A HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
USD 1,020.00
5 Weeks
Lenti ORF particles, RAB5A (Myc-DDK tagged) - Human RAB5A, member RAS oncogene family (RAB5A), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,020.00
6 Weeks
Lenti ORF particles, RAB5A (mGFP-tagged) - Human RAB5A, member RAS oncogene family (RAB5A), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit polyclonal Rab5 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Monkey, Bovine, Rat. Not tested in other species |
Conjugation | Unconjugated |
Immunogen | Human Rab5 synthetic peptide conjugated to KLH; identical to dog Rab5 sequence over the residues |
Rabbit polyclonal Rab5 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This Rab5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 182-211 amino acids from the C-terminal region of human Rab5. |
Rabbit Polyclonal Anti-Rab5 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Rab5 Antibody: Peptide sequence around aa.188~192( N-P-G-A-N) derived from Human Rab5. |
Rabbit Polyclonal Anti-Rab5A Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Rab5A Antibody: A synthesized peptide derived from human Rab5A |
Goat Polyclonal Anti-Rab5a Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 115 aa to the C-terminus of mouse Rab5a produced in E. coli. |
Lenti ORF clone of Human RAB5A, member RAS oncogene family (RAB5A), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
RAB5A (untagged)-Human RAB5A, member RAS oncogene family (RAB5A)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of RAB5A, member RAS oncogene family (RAB5A)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit polyclonal Anti-RAB5A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Zebrafish |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RAB5A antibody: synthetic peptide directed towards the middle region of human RAB5A. Synthetic peptide located within the following region: KTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCS |
Rabbit polyclonal Rab4 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat. Not yet tested on other species |
Conjugation | Unconjugated |
Immunogen | C-terminal peptide from human Rab4 |
Rabbit polyclonal Anti-RAB5A Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RAB5A antibody: synthetic peptide directed towards the middle region of human RAB5A. Synthetic peptide located within the following region: SFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNS |
RAB5A / RAB5 (1-215) human recombinant protein, 0.5 mg
Expression Host | E. coli |
RAB5A / RAB5 (1-215) human recombinant protein, 0.1 mg
Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) RAB5A mouse monoclonal antibody,clone OTI6D9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RAB5A MS Standard C13 and N15-labeled recombinant protein (NP_004153)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
RAB5A (GFP-tagged) - Human RAB5A, member RAS oncogene family (RAB5A), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
RAB5A (untagged) - Human RAB5A, member RAS oncogene family (RAB5A), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Anti-RAB5A Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1-16 amino acids of Human Ras-related protein Rab-5A |
Anti-RAB5A Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1-16 amino acids of Human Ras-related protein Rab-5A |
RAB5A mouse monoclonal antibody,clone OTI6D9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RAB5A mouse monoclonal antibody,clone OTI6D9, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
RAB5A mouse monoclonal antibody,clone OTI6D9, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RAB5A mouse monoclonal antibody,clone OTI6D9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of RAB5A (NM_004162) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RAB5A (NM_001292048) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RAB5A (NM_004162) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of RAB5A (NM_004162) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of RAB5A (NM_001292048) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack