Germany
Japan
United Kingdom
China
Lenti ORF particles, DDB2 (mGFP-tagged) - Human damage-specific DNA binding protein 2, 48kDa (DDB2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Products
View as table Download
DDB2 (Myc-DDK-tagged)-Human damage-specific DNA binding protein 2, 48kDa (DDB2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Lenti ORF particles, DDB2 (Myc-DDK tagged) - Human damage-specific DNA binding protein 2, 48kDa (DDB2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
-
Lenti ORF particles, DDB2 (mGFP-tagged) - Human damage-specific DNA binding protein 2, 48kDa (DDB2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
-
DDB2 (GFP-tagged) - Human damage-specific DNA binding protein 2, 48kDa (DDB2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, DDB2 (Myc-DDK tagged) - Human damage-specific DNA binding protein 2, 48kDa (DDB2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human damage-specific DNA binding protein 2, 48kDa (DDB2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
DDB2 (myc-DDK-tagged) - Human damage-specific DNA binding protein 2, 48kDa (DDB2), transcript variant D1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DDB2 (untagged)-Human damage-specific DNA binding protein 2, 48kDa (DDB2)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human damage-specific DNA binding protein 2, 48kDa (DDB2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human damage-specific DNA binding protein 2, 48kDa (DDB2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of damage-specific DNA binding protein 2, 48kDa (DDB2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human damage-specific DNA binding protein 2, 48kDa (DDB2), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-DDB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDB2 antibody: synthetic peptide directed towards the C terminal of human DDB2. Synthetic peptide located within the following region: IVVGRYPDPNFKSCTPYELRTIDVFDGNSGKMMCQLYDPESSGISSLNEF |
Purified recombinant protein of Human damage-specific DNA binding protein 2, 48kDa (DDB2),Met1-Leu250, with N-terminal His tag, expressed in E. coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) DDB2 mouse monoclonal antibody,clone OTI2E12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
DDB2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
DDB2 (GFP-tagged) - Human damage-specific DNA binding protein 2, 48kDa (DDB2), transcript variant D1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DDB2 (untagged) - Human damage-specific DNA binding protein 2, 48kDa (DDB2), transcript variant D1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
DDB2 mouse monoclonal antibody,clone OTI2E12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
DDB2 mouse monoclonal antibody,clone OTI2E12, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
DDB2 mouse monoclonal antibody,clone OTI2E12, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
DDB2 mouse monoclonal antibody,clone OTI2E12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Transient overexpression of DDB2 (NM_000107) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of DDB2 (NM_001300734) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of DDB2 (NM_000107) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of DDB2 (NM_000107) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of DDB2 (NM_001300734) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- DDB2
Families
- Druggable Genome
Pathways
- Nucleotide excision repair