Germany
Japan
United Kingdom
China
AREG (Myc-DDK-tagged)-Human amphiregulin (AREG)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 820.00
3 Weeks
Lenti ORF particles, AREG (Myc-DDK tagged) - Human amphiregulin (AREG), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, AREG (mGFP-tagged) - Human amphiregulin (AREG), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
AREG (GFP-tagged) - Human amphiregulin (AREG)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
AREG (untagged)-Human amphiregulin (AREG)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
USD 820.00
5 Weeks
Lenti ORF particles, AREG (Myc-DDK tagged) - Human amphiregulin (AREG), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, AREG (mGFP-tagged) - Human amphiregulin (AREG), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Purified recombinant protein of Human amphiregulin (AREG).
| Tag | Tag Free |
| Expression Host | E. coli |
Lenti ORF clone of Human amphiregulin (AREG), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of amphiregulin (AREG)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit anti-AREG Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AREG |
Rabbit Polyclonal Anti-AREG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human AREG |
Purified recombinant protein of Human amphiregulin (AREG), full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug
| Tag | N-GST and C-His |
| Expression Host | E. coli |
Rabbit Polyclonal anti-AREG antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AREG antibody: synthetic peptide directed towards the middle region of human AREG. Synthetic peptide located within the following region: PQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNR |
AREG HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Transient overexpression of AREG (NM_001657) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human amphiregulin (AREG)
| Tag | tag free |
| Expression Host | E. coli |
Purified recombinant protein of Human amphiregulin (AREG)
| Tag | tag free |
| Expression Host | E. coli |
Purified recombinant protein of Human amphiregulin (AREG)
| Tag | tag free |
| Expression Host | E. coli |
Purified recombinant protein of Human amphiregulin (AREG)
| Tag | tag free |
| Expression Host | E. coli |
Transient overexpression of AREG (NM_001657) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of AREG (NM_001657) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- AREG
Families
- Druggable Genome