AREG (Myc-DDK-tagged)-Human amphiregulin (AREG)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
AREG (Myc-DDK-tagged)-Human amphiregulin (AREG)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, AREG (Myc-DDK tagged) - Human amphiregulin (AREG), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
3 Weeks
Lenti ORF particles, AREG (mGFP-tagged) - Human amphiregulin (AREG), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
AREG (GFP-tagged) - Human amphiregulin (AREG)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
AREG (untagged)-Human amphiregulin (AREG)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
USD 820.00
5 Weeks
Lenti ORF particles, AREG (Myc-DDK tagged) - Human amphiregulin (AREG), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, AREG (mGFP-tagged) - Human amphiregulin (AREG), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Purified recombinant protein of Human amphiregulin (AREG).
Tag | Tag Free |
Expression Host | E. coli |
Lenti ORF clone of Human amphiregulin (AREG), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Transient overexpression lysate of amphiregulin (AREG)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit anti-AREG Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human AREG |
Rabbit Polyclonal Anti-AREG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human AREG |
Purified recombinant protein of Human amphiregulin (AREG), full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug
Tag | N-GST and C-His |
Expression Host | E. coli |
Rabbit Polyclonal anti-AREG antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AREG antibody: synthetic peptide directed towards the middle region of human AREG. Synthetic peptide located within the following region: PQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNR |
AREG HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Transient overexpression of AREG (NM_001657) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human amphiregulin (AREG)
Tag | tag free |
Expression Host | E. coli |
Purified recombinant protein of Human amphiregulin (AREG)
Tag | tag free |
Expression Host | E. coli |
Purified recombinant protein of Human amphiregulin (AREG)
Tag | tag free |
Expression Host | E. coli |
Purified recombinant protein of Human amphiregulin (AREG)
Tag | tag free |
Expression Host | E. coli |
Transient overexpression of AREG (NM_001657) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of AREG (NM_001657) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack