Germany
Japan
United Kingdom
China
Purified recombinant protein of Homo sapiens BCL2-associated athanogene 3 (BAG3)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Products
View as table Download
BAG3 (GFP-tagged) - Human BCL2-associated athanogene 3 (BAG3)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
BAG3 (Myc-DDK-tagged)-Human BCL2-associated athanogene 3 (BAG3)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, BAG3 (Myc-DDK tagged) - Human BCL2-associated athanogene 3 (BAG3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, BAG3 (mGFP-tagged) - Human BCL2-associated athanogene 3 (BAG3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, BAG3 (Myc-DDK tagged) - Human BCL2-associated athanogene 3 (BAG3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, BAG3 (mGFP-tagged) - Human BCL2-associated athanogene 3 (BAG3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human BCL2-associated athanogene 3 (BAG3), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human BCL2-associated athanogene 3 (BAG3), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
BAG3 (untagged)-Human BCL2-associated athanogene 3 (BAG3)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
BAG3 (untagged)-Human BCL2-associated athanogene 3 (BAG3)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human BCL2-associated athanogene 3 (BAG3), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Rabbit Polyclonal Anti-BAG3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BAG3 antibody: synthetic peptide directed towards the middle region of human BAG3. Synthetic peptide located within the following region: NVTRPAAQPSFHQAQKTHYPAQQGEYQTHQPVYHKIQGDDWEPRPLRAAS |
BAG3 MS Standard C13 and N15-labeled recombinant protein (NP_004272)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Lenti ORF clone of Human BCL2-associated athanogene 3 (BAG3), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Goat Anti-BAG3 / BIS/ CAIR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SSMTDTPGNPAAP, from the C Terminus of the protein sequence according to NP_004272.2. |
BAG3 (1-575, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
BAG3 (1-575, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
Transient overexpression of BAG3 (NM_004281) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of BAG3 (NM_004281) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of BAG3 (NM_004281) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- BAG3
Families
- Druggable Genome