CD81 (Myc-DDK-tagged)-Human CD81 molecule (CD81)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CD81 (Myc-DDK-tagged)-Human CD81 molecule (CD81)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CD81 (GFP-tagged) - Human CD81 molecule (CD81)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, CD81 (mGFP-tagged) - Human CD81 molecule (CD81), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Rabbit Polyclonal Anti-CD81 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
Transient overexpression lysate of CD81 molecule (CD81)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
TAPA1 (CD81) mouse monoclonal antibody, clone M38, PE
Applications | FC |
Reactivities | Feline, Human, Rabbit |
Conjugation | PE |
Lenti ORF clone of Human CD81 molecule (CD81), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CD81 (Myc-DDK tagged) - Human CD81 molecule (CD81), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human CD81 molecule (CD81), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CD81 (mGFP-tagged) - Human CD81 molecule (CD81), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CD81 (myc-DDK-tagged) - Human CD81 molecule (CD81), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TAPA1 (CD81) mouse monoclonal antibody, clone M38, Purified
Applications | FC, FN, IF, IHC, IP, WB |
Reactivities | Feline, Human, Rabbit |
CD81 (untagged)-Human CD81 molecule (CD81)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
CD81 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human CD81 molecule (CD81), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal CD81 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CD81 antibody was raised against a 20 amino acid peptide near the amino terminus of human CD81. |
Mouse Monoclonal CD81 Antibody (1D6)
Applications | FC, IHC, WB |
Reactivities | Human, Goat, Primate, Sheep |
Conjugation | Unconjugated |
CD81 (untagged) - Human CD81 molecule (CD81), transcript variant 2
Vector | PCMV6-Neo |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human CD81 molecule (CD81), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
TAPA1 (CD81) mouse monoclonal antibody, clone M38, FITC
Applications | FC |
Reactivities | Feline, Human, Rabbit |
Conjugation | FITC |
TAPA1 (CD81) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide |
CD81 MS Standard C13 and N15-labeled recombinant protein (NP_004347)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Lenti ORF particles, CD81 (Myc-DDK tagged) - Human CD81 molecule (CD81), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
CD81 (GFP-tagged) - Human CD81 molecule (CD81), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Transient overexpression of CD81 (NM_004356) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CD81 (NM_001297649) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CD81 (NM_004356) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CD81 (NM_004356) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CD81 (NM_001297649) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack