Germany
Japan
United Kingdom
China
CRY1 (Myc-DDK-tagged)-Human cryptochrome 1 (photolyase-like) (CRY1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human cryptochrome 1 (photolyase-like) (CRY1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
USD 880.00
3 Weeks
Lenti ORF particles, CRY1 (Myc-DDK tagged) - Human cryptochrome 1 (photolyase-like) (CRY1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 880.00
6 Weeks
Lenti ORF particles, CRY1 (mGFP-tagged) - Human cryptochrome 1 (photolyase-like) (CRY1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
CRY1 (GFP-tagged) - Human cryptochrome 1 (photolyase-like) (CRY1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal Anti-CRY1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CRY1 antibody: synthetic peptide directed towards the N terminal of human CRY1. Synthetic peptide located within the following region: KRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGF |
Lenti ORF clone of Human cryptochrome 1 (photolyase-like) (CRY1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 880.00
5 Weeks
Lenti ORF particles, CRY1 (Myc-DDK tagged) - Human cryptochrome 1 (photolyase-like) (CRY1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cryptochrome 1 (photolyase-like) (CRY1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 880.00
3 Weeks
Lenti ORF particles, CRY1 (mGFP-tagged) - Human cryptochrome 1 (photolyase-like) (CRY1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cryptochrome 1 (photolyase-like) (CRY1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of cryptochrome 1 (photolyase-like) (CRY1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
CRY1 (untagged)-Human cryptochrome 1 (photolyase-like) (CRY1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human cryptochrome 1 (photolyase-like) (CRY1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
CRY1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal anti-CRY1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human CRY1. |
Carrier-free (BSA/glycerol-free) CRY1 mouse monoclonal antibody,clone OTI2C10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CRY1 mouse monoclonal antibody,clone OTI6C6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
CRY1 MS Standard C13 and N15-labeled recombinant protein (NP_004066)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
CRY1 mouse monoclonal antibody,clone OTI2C10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
CRY1 mouse monoclonal antibody,clone OTI2C10, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
CRY1 mouse monoclonal antibody,clone OTI2C10, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
CRY1 mouse monoclonal antibody,clone OTI2C10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
CRY1 mouse monoclonal antibody,clone OTI2F5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
CRY1 mouse monoclonal antibody,clone OTI6C6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
CRY1 mouse monoclonal antibody,clone OTI6C6, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
CRY1 mouse monoclonal antibody,clone OTI6C6, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
CRY1 mouse monoclonal antibody,clone OTI6C6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Transient overexpression of CRY1 (NM_004075) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CRY1 (NM_004075) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CRY1 (NM_004075) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CRY1
Families
- Druggable Genome