ADRBK2 (Myc-DDK-tagged)-Human adrenergic, beta, receptor kinase 2 (ADRBK2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ADRBK2 (Myc-DDK-tagged)-Human adrenergic, beta, receptor kinase 2 (ADRBK2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, ADRBK2 (Myc-DDK tagged) - Human adrenergic, beta, receptor kinase 2 (ADRBK2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, ADRBK2 (mGFP-tagged) - Human adrenergic, beta, receptor kinase 2 (ADRBK2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
ADRBK2 (GFP-tagged) - Human adrenergic, beta, receptor kinase 2 (ADRBK2)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human adrenergic, beta, receptor kinase 2 (ADRBK2), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ADRBK2 (Myc-DDK tagged) - Human adrenergic, beta, receptor kinase 2 (ADRBK2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human adrenergic, beta, receptor kinase 2 (ADRBK2), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ADRBK2 (mGFP-tagged) - Human adrenergic, beta, receptor kinase 2 (ADRBK2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human adrenergic, beta, receptor kinase 2 (ADRBK2), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
ADRBK2 (untagged)-Human adrenergic, beta, receptor kinase 2 (ADRBK2)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
ADRBK2 (untagged)-Kinase deficient mutant (K220M) of Human adrenergic, beta, receptor kinase 2 (ADRBK2)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
ADRBK2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ADRBK2 |
Lenti ORF clone of Human adrenergic, beta, receptor kinase 2 (ADRBK2), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
GRK3 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 36~65 amino acids from the N-terminal region of human ADRBK2 |
ADRBK2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GRK3 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Rabbit polyclonal anti-GRK3 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | he antiserum was produced against synthesized peptide derived from internal of human GRK3. |
Rabbit Polyclonal Anti-ADRBK2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ADRBK2 antibody: synthetic peptide directed towards the N terminal of human ADRBK2. Synthetic peptide located within the following region: FCLNEINEAVPQVKFYEEIKEYEKLDNEEDRLCRSRQIYDAYIMKELLSC |
Transient overexpression lysate of adrenergic, beta, receptor kinase 2 (ADRBK2)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
ADRBK2 (untagged)-ORIGENE UNIQUE VARIANT 1 of Human adrenergic, beta, receptor kinase 2 (ADRBK2)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-ADRBK2 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ADRBK2 |
Transient overexpression of GRK3 (NM_005160) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GRK3 (NM_005160) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GRK3 (NM_005160) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack