Germany
Japan
United Kingdom
China
HNF1A (Myc-DDK-tagged)-Human HNF1 homeobox A (HNF1A)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadHNF1A (untagged)-Human HNF1 homeobox A (HNF1A)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Recombinant protein of human HNF1 homeobox A (HNF1A)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
HNF1A (GFP-tagged) - Human HNF1 homeobox A (HNF1A)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 820.00
5 Weeks
Lenti ORF particles, HNF1A (mGFP-tagged) - Human HNF1 homeobox A (HNF1A), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF clone of Human HNF1 homeobox A (HNF1A), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, HNF1A (Myc-DDK tagged) - Human HNF1 homeobox A (HNF1A), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human HNF1 homeobox A (HNF1A), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Rabbit Polyclonal Anti-HNF1A Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNF1A antibody: synthetic peptide directed towards the N terminal of human HNF1A. Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE |
Goat Polyclonal Anti-cardiac troponin T (aa201-213) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Pig (Expected from sequence similarity: Feline, Rat, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-cardiac troponin T (aa201-213) Antibody: Peptide with sequence C-TERKSGKRQTERE, from the internal region of the protein sequence according to NP_000355.2; NP_001001430.1; NP_001001431.1; NP_001001432.1. |
Transient overexpression lysate of HNF1 homeobox A (HNF1A)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
HNF1A HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Anti-HNF1A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 57-70 amino acids of human HNF1 homeobox A |
Rabbit Polyclonal Anti-HNF1A
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNF1A antibody: synthetic peptide directed towards the N terminal of human HNF1A. Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE |
Rabbit polyclonal HNF1A Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This HNF1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 177-205 amino acids from the Central region of human HNF1A. |
Purified recombinant protein of Human HNF1 homeobox A (HNF1A), mutant (C236S), expressed in HEK293 cells, 20ug
| Tag | C-Myc/DDK |
Purified recombinant protein of Human HNF1 homeobox A (HNF1A), mutant (C241S), expressed in HEK293 cells, 20ug
| Tag | C-Myc/DDK |
Purified recombinant protein of Human HNF1 homeobox A (HNF1A), mutant (C50S), expressed in HEK293 cells, 20ug
| Tag | C-Myc/DDK |
Rabbit Polyclonal anti-HNF1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HNF1A antibody is: synthetic peptide directed towards the C-terminal region of Human HNF1A. Synthetic peptide located within the following region: QTMLITDTTNLSALASLTPTKQVFTSDTEASSESGLHTPASQATTLHVPS |
HNF1A MS Standard C13 and N15-labeled recombinant protein (NP_000536)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of HNF1A (NM_000545) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of HNF1A (NM_000545) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of HNF1A (NM_000545) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- HNF1A
Families
- Druggable Genome