Products

cDNA Clones (29)
Proteins (19)
Antibodies (17)
Jump to Filters
View as table Download
IVD (NM_002225) Human Tagged ORF Clone
RC201077

USD 420.00

In Stock

IVD (Myc-DDK-tagged)-Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
IVD (NM_001159508) Human Tagged ORF Clone
RC228318

USD 420.00

In Stock

IVD (Myc-DDK-tagged)-Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
IVD (NM_002225) Human Tagged ORF Clone
RC229217

USD 420.00

In Stock

IVD (Myc-DDK-tagged)-Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
IVD (NM_002225) Human Recombinant Protein
TP301077

USD 823.00

In Stock

Recombinant protein of human isovaleryl Coenzyme A dehydrogenase (IVD), nuclear gene encoding mitochondrial protein

Tag C-Myc/DDK
Expression Host HEK293T
IVD (NM_002225) Human Tagged ORF Clone Lentiviral Particle
RC201077L1V

USD 820.00

3 Weeks

Lenti ORF particles, IVD (Myc-DDK tagged) - Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
IVD (NM_002225) Human Tagged ORF Clone Lentiviral Particle
RC201077L2V

USD 820.00

6 Weeks

Lenti ORF particles, IVD (mGFP-tagged) - Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
IVD (NM_002225) Human Tagged ORF Clone Lentiviral Particle
RC229217L1V

USD 820.00

6 Weeks

Lenti ORF particles, IVD (Myc-DDK tagged) - Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
IVD (NM_002225) Human Tagged ORF Clone Lentiviral Particle
RC229217L2V

USD 820.00

3 Weeks

Lenti ORF particles, IVD (mGFP-tagged) - Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
IVD (NM_002225) Human Tagged ORF Clone
RG201077

USD 460.00

In Stock

IVD (GFP-tagged) - Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
IVD (NM_002225) Human Tagged ORF Clone
RC201077L3

USD 620.00

3 Weeks

Lenti ORF clone of Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
IVD (NM_002225) Human Tagged ORF Clone Lentiviral Particle
RC201077L3V

USD 820.00

5 Weeks

Lenti ORF particles, IVD (Myc-DDK tagged) - Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
IVD (NM_002225) Human Tagged ORF Clone
RC201077L4

USD 620.00

3 Weeks

Lenti ORF clone of Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
IVD (NM_002225) Human Tagged ORF Clone Lentiviral Particle
RC201077L4V

USD 820.00

7 Weeks

Lenti ORF particles, IVD (mGFP-tagged) - Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
IVD (NM_001159508) Human Tagged ORF Clone
RC228318L3

USD 620.00

3 Weeks

Lenti ORF clone of Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
IVD (NM_001159508) Human Tagged ORF Clone Lentiviral Particle
RC228318L3V

USD 820.00

6 Weeks

Lenti ORF particles, IVD (Myc-DDK tagged) - Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
IVD (NM_001159508) Human Tagged ORF Clone
RC228318L4

USD 620.00

3 Weeks

Lenti ORF clone of Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
IVD (NM_001159508) Human Tagged ORF Clone Lentiviral Particle
RC228318L4V

USD 820.00

6 Weeks

Lenti ORF particles, IVD (mGFP-tagged) - Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
IVD (NM_002225) Human Tagged ORF Clone
RC229217L3

USD 620.00

3 Weeks

Lenti ORF clone of Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
IVD (NM_002225) Human Tagged ORF Clone Lentiviral Particle
RC229217L3V

USD 820.00

7 Weeks

Lenti ORF particles, IVD (Myc-DDK tagged) - Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
IVD (NM_002225) Human Tagged ORF Clone
RC229217L4

USD 620.00

3 Weeks

Lenti ORF clone of Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
IVD (NM_002225) Human Tagged ORF Clone Lentiviral Particle
RC229217L4V

USD 820.00

5 Weeks

Lenti ORF particles, IVD (mGFP-tagged) - Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
IVD (NM_001159508) Human Tagged ORF Clone
RG228318

USD 460.00

3 Weeks

IVD (GFP-tagged) - Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
IVD (NM_002225) Human Tagged ORF Clone
RG229217

USD 460.00

3 Weeks

IVD (GFP-tagged) - Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
IVD (NM_002225) Human Tagged Lenti ORF Clone
RC229217L2

USD 768.00

In Stock

Lenti ORF clone of Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
IVD (NM_002225) Human Tagged ORF Clone
RC201077L1

USD 768.00

In Stock

Lenti ORF clone of Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
IVD Rabbit Polyclonal Antibody
TA344320

USD 475.00

5 Days

Rabbit Polyclonal Anti-IVD Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IVD antibody is: synthetic peptide directed towards the N-terminal region of Human IVD. Synthetic peptide located within the following region: APKAQEIDRSNEFKNLREFWKQLGNLGVLGITAPVQYGGSGLGYLEHVLV
IVD (NM_002225) Human Tagged ORF Clone
RC201077L2

USD 620.00

3 Weeks

Lenti ORF clone of Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
IVD (NM_002225) Human Tagged ORF Clone
RC229217L1

USD 620.00

3 Weeks

Lenti ORF clone of Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
IVD Rabbit Polyclonal Antibody
TA308023

USD 415.00

5 Days

Rabbit Polyclonal antibody to IVD (isovaleryl Coenzyme A dehydrogenase)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 222 of IVD (Uniprot ID#P26440)
IVD (NM_002225) Human Over-expression Lysate
LC419463

USD 121.00

In Stock

IVD HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
IVD (NM_002225) Human Over-expression Lysate
LC432239

USD 121.00

In Stock

IVD HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
IVD (NM_002225) Human Untagged Clone
SC319252

USD 720.00

In Stock

IVD (untagged)-Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
IVD (NM_002225) Human Over-expression Lysate
LY419463

USD 396.00

5 Days

Transient overexpression lysate of isovaleryl Coenzyme A dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

IVD (33-426, His-tag) Human Protein
AR09386PU-L

USD 745.00

2 Weeks

IVD (33-426, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
IVD (33-426, His-tag) Human Protein
AR09386PU-N

USD 300.00

2 Weeks

IVD (33-426, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
IVD Mouse Monoclonal Antibody [Clone ID: OTI5A11]
CF501544

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) IVD mouse monoclonal antibody, clone OTI5A11 (formerly 5A11)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
IVD Mouse Monoclonal Antibody [Clone ID: OTI1F1]
CF501670

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) IVD mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
IVD Mouse Monoclonal Antibody [Clone ID: OTI1B10]
CF501742

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) IVD mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
IVD (NM_001159508) Human Over-expression Lysate
LC431346

USD 121.00

2 Weeks

IVD HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
IVD (NM_001159508) Human Over-expression Lysate
LY431346

USD 396.00

5 Days

Transient overexpression lysate of isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

IVD (NM_002225) Human Over-expression Lysate
LY432239

USD 396.00

5 Days

Transient overexpression lysate of isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

IVD (NM_002225) Human Mass Spec Standard
PH301077

USD 2,055.00

3 Weeks

IVD MS Standard C13 and N15-labeled recombinant protein (NP_002216)

Tag C-Myc/DDK
Expression Host HEK293
IVD (NM_001159508) Human Untagged Clone
SC326953

USD 680.00

3 Weeks

IVD (untagged)-Human isovaleryl Coenzyme A dehydrogenase (IVD) transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
IVD (NM_002225) Human Untagged Clone
SC327852

USD 720.00

3 Weeks

IVD (untagged)-Human isovaleryl Coenzyme A dehydrogenase (IVD) nuclear gene encoding mitochondrial protein transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
IVD Mouse Monoclonal Antibody [Clone ID: OTI5A11]
TA501544

USD 379.00

In Stock

Anti-IVD mouse monoclonal antibody, clone OTI5A11 (formerly 5A11)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
IVD Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5A11]
TA501544AM

USD 420.00

4 Weeks

Anti-IVD mouse monoclonal antibody, clone OTI5A11 (formerly 5A11), Biotinylated

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Biotin
IVD Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5A11]
TA501544BM

USD 420.00

4 Weeks

Anti-IVD mouse monoclonal antibody, clone OTI5A11 (formerly 5A11), HRP conjugated

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation HRP
IVD Mouse Monoclonal Antibody [Clone ID: OTI5A11]
TA501544S

USD 159.00

2 Days

Anti-IVD mouse monoclonal antibody, clone OTI5A11 (formerly 5A11)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
IVD Mouse Monoclonal Antibody [Clone ID: OTI1F1]
TA501670

USD 379.00

In Stock

Anti-IVD mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated