Products

View as table Download

MAPK6 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 6 (MAPK6)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, MAPK6 (Myc-DDK tagged) - Human mitogen-activated protein kinase 6 (MAPK6), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, MAPK6 (mGFP-tagged) - Human mitogen-activated protein kinase 6 (MAPK6), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Rabbit monoclonal anti-ERK3 antibody for SISCAPA, clone OTIR5F3

Applications SISCAPA
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Lenti ORF clone of Human mitogen-activated protein kinase 6 (MAPK6), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MAPK6 (Myc-DDK tagged) - Human mitogen-activated protein kinase 6 (MAPK6), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human mitogen-activated protein kinase 6 (MAPK6), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MAPK6 (mGFP-tagged) - Human mitogen-activated protein kinase 6 (MAPK6), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

MAPK6 (GFP-tagged) - Human mitogen-activated protein kinase 6 (MAPK6)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Purified recombinant protein of Human mitogen-activated protein kinase 6 (MAPK6), with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli

Lenti ORF clone of Human mitogen-activated protein kinase 6 (MAPK6), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

MAPK6 (untagged)-Human mitogen-activated protein kinase 6 (MAPK6)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit polyclonal anti-p97 MAPK antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human p97 MAPK.

Rabbit Polyclonal Anti-p97 MAPK Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-p97 MAPK Antibody: A synthesized peptide derived from human p97 MAPK

Lenti ORF clone of Human mitogen-activated protein kinase 6 (MAPK6), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

MAPK6 (untagged)-Kinase deficient mutant (K49M) of Human mitogen-activated protein kinase 6 (MAPK6)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

MAPK6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

Rabbit polyclonal anti-MAPK9 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MAPK9.

Rabbit polyclonal Anti-MAPK6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAPK6 antibody: synthetic peptide directed towards the middle region of human MAPK6. Synthetic peptide located within the following region: QVDPRKYLDGDREKYLEDPAFDTNYSTEPCWQYSDHHENKYCDLECSHTC

Carrier-free (BSA/glycerol-free) ERK3 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ERK3 mouse monoclonal antibody, clone OTI5E1 (formerly 5E1)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-MAPK6 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human MAPK6

Anti-ERK3 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-ERK3 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-ERK3 mouse monoclonal antibody, clone OTI5E1 (formerly 5E1)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-ERK3 mouse monoclonal antibody, clone OTI5E1 (formerly 5E1)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

USD 1,260.00

4 Weeks

Transient overexpression of MAPK6 (NM_002748) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of MAPK6 (NM_002748) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of MAPK6 (NM_002748) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack