MAPK6 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 6 (MAPK6)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
MAPK6 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 6 (MAPK6)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, MAPK6 (Myc-DDK tagged) - Human mitogen-activated protein kinase 6 (MAPK6), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, MAPK6 (mGFP-tagged) - Human mitogen-activated protein kinase 6 (MAPK6), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Rabbit monoclonal anti-ERK3 antibody for SISCAPA, clone OTIR5F3
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Lenti ORF clone of Human mitogen-activated protein kinase 6 (MAPK6), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MAPK6 (Myc-DDK tagged) - Human mitogen-activated protein kinase 6 (MAPK6), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human mitogen-activated protein kinase 6 (MAPK6), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MAPK6 (mGFP-tagged) - Human mitogen-activated protein kinase 6 (MAPK6), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
MAPK6 (GFP-tagged) - Human mitogen-activated protein kinase 6 (MAPK6)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Purified recombinant protein of Human mitogen-activated protein kinase 6 (MAPK6), with N-terminal HIS tag, expressed in E.Coli, 50ug
Tag | N-His |
Expression Host | E. coli |
Lenti ORF clone of Human mitogen-activated protein kinase 6 (MAPK6), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
MAPK6 (untagged)-Human mitogen-activated protein kinase 6 (MAPK6)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-p97 MAPK antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human p97 MAPK. |
Rabbit Polyclonal Anti-p97 MAPK Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-p97 MAPK Antibody: A synthesized peptide derived from human p97 MAPK |
Lenti ORF clone of Human mitogen-activated protein kinase 6 (MAPK6), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
MAPK6 (untagged)-Kinase deficient mutant (K49M) of Human mitogen-activated protein kinase 6 (MAPK6)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
MAPK6 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Transient overexpression lysate of mitogen-activated protein kinase 6 (MAPK6)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit polyclonal anti-MAPK9 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MAPK9. |
Rabbit polyclonal Anti-MAPK6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAPK6 antibody: synthetic peptide directed towards the middle region of human MAPK6. Synthetic peptide located within the following region: QVDPRKYLDGDREKYLEDPAFDTNYSTEPCWQYSDHHENKYCDLECSHTC |
Carrier-free (BSA/glycerol-free) ERK3 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ERK3 mouse monoclonal antibody, clone OTI5E1 (formerly 5E1)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-MAPK6 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MAPK6 |
Anti-ERK3 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-ERK3 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Anti-ERK3 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-ERK3 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-ERK3 mouse monoclonal antibody, clone OTI5E1 (formerly 5E1)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-ERK3 mouse monoclonal antibody, clone OTI5E1 (formerly 5E1), Biotinylated
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Anti-ERK3 mouse monoclonal antibody, clone OTI5E1 (formerly 5E1), HRP conjugated
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-ERK3 mouse monoclonal antibody, clone OTI5E1 (formerly 5E1)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of MAPK6 (NM_002748) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MAPK6 (NM_002748) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MAPK6 (NM_002748) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack