Germany
Japan
United Kingdom
China
MECP2 (Myc-DDK-tagged)-Human methyl CpG binding protein 2 (Rett syndrome) (MECP2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, MECP2 (mGFP-tagged) - Human methyl CpG binding protein 2 (Rett syndrome) (MECP2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
MECP2 (GFP-tagged) - Human methyl CpG binding protein 2 (Rett syndrome) (MECP2), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, MECP2 (Myc-DDK tagged) - Human methyl CpG binding protein 2 (Rett syndrome) (MECP2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
MECP2 (Myc-DDK-tagged)-Human methyl CpG binding protein 2 (Rett syndrome) (MECP2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, MECP2 (Myc-DDK-tagged)-Human methyl CpG binding protein 2 (Rett syndrome) (MECP2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, MECP2 (mGFP-tagged)-Human methyl CpG binding protein 2 (Rett syndrome) (MECP2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Transient overexpression lysate of methyl CpG binding protein 2 (Rett syndrome) (MECP2), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human methyl CpG binding protein 2 (Rett syndrome) (MECP2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MECP2 (Myc-DDK tagged) - Human methyl CpG binding protein 2 (Rett syndrome) (MECP2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, MECP2 (mGFP-tagged) - Human methyl CpG binding protein 2 (Rett syndrome) (MECP2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of MECP2 (Myc-DDK-tagged)-Human methyl CpG binding protein 2 (Rett syndrome) (MECP2), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MECP2 (Myc-DDK-tagged)-Human methyl CpG binding protein 2 (Rett syndrome) (MECP2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of MECP2 (mGFP-tagged)-Human methyl CpG binding protein 2 (Rett syndrome) (MECP2), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MECP2 (mGFP-tagged)-Human methyl CpG binding protein 2 (Rett syndrome) (MECP2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
MECP2 (GFP-tagged) - Human methyl CpG binding protein 2 (Rett syndrome) (MECP2), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human methyl CpG binding protein 2 (Rett syndrome) (MECP2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human methyl CpG binding protein 2 (Rett syndrome) (MECP2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human methyl CpG binding protein 2 (Rett syndrome) (MECP2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti-ORF clone of MECP2 (Myc-DDK-tagged)-Human methyl CpG binding protein 2 (Rett syndrome) (MECP2), transcript variant 2
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
MECP2 (untagged)-Human methyl CpG binding protein 2 (Rett syndrome) (MECP2), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal MeCP2 Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MeCP2 antibody: MeCP2 (Methyl-CpG-binding domain protein 2), using a KLH-conjugated synthetic peptide containing a sequence from the C-terminal part of the protein. |
Rabbit Polyclonal MeCP2 Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MeCP2 antibody: human MeCP2 (Methyl-CpG-binding domain protein 2), using 3 different KLH-conjugated synthetic peptides containing an amino acid sequence from the N-terminal, the central and the C-terminal part of the protein, respec |
MECP2 (untagged)-Human methyl CpG binding protein 2 (Rett syndrome) (MECP2), transcript variant 2
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Anti-MeCP2 (Ser80) Antibody (Phospho-Specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phospho-peptide corresponding to amino acid residues surrounding Ser80 conjugated to KLH |
| Modifications | Phospho-specific |
MECP2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti-ORF clone of MECP2 (mGFP-tagged)-Human methyl CpG binding protein 2 (Rett syndrome) (MECP2), transcript variant 2
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal MeCP2 Antibody
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Immunogen | The immunogen for anti-MeCP2 antibody: mouse MeCP2 (Methyl-CpG-binding domain Protein 2), using a KLH-conjugated synthetic peptide containing an amino acid sequence from the N-terminal part of the protein. |
Rabbit Polyclonal Anti-MECP2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MECP2 antibody: synthetic peptide directed towards the N terminal of human MECP2. Synthetic peptide located within the following region: KKEEKEGKHEPVQPSAHHSAEPAEAGKAETSEGSGSAPAVPEASASPKQR |
Rabbit Polyclonal Anti-MECP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MECP2 Antibody: synthetic peptide directed towards the N terminal of human MECP2. Synthetic peptide located within the following region: MVAGMLGLREEKSEDQDLQGLKEKPLKFKKVKKDKKEDKEGKHEPLQPSA |
Rabbit Polyclonal Anti-MECP2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MECP2 antibody: synthetic peptide directed towards the middle region of human MECP2. Synthetic peptide located within the following region: EPAKTQPAVATAATAAEKYKHRGEGERKDIVSSSMPRPNREEPVDSRTPV |
Rabbit Polyclonal MeCP2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | The immunogen for anti-MeCP2 antibody: human MeCP2 (Methyl-CpG-binding domain protein 2), using a recombinant protein. |
USD 420.00
4 Weeks
Transient overexpression of MECP2 (NM_004992) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MECP2 (NM_001110792) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MECP2 (NM_004992) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MECP2 (NM_004992) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of MECP2 (NM_001110792) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MECP2 (NM_001110792) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- MECP2
Families
- Druggable Genome