Germany
Japan
United Kingdom
China
Lenti ORF particles, MTA2 (Myc-DDK-tagged)-Human metastasis associated 1 family, member 2 (MTA2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Products
View as table DownloadLenti ORF particles, MTA2 (mGFP-tagged)-Human metastasis associated 1 family, member 2 (MTA2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
MTA2 (Myc-DDK-tagged)-Human metastasis associated 1 family, member 2 (MTA2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MTA2 (GFP-tagged) - Human metastasis associated 1 family, member 2 (MTA2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of MTA2 (Myc-DDK-tagged)-Human metastasis associated 1 family, member 2 (MTA2)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MTA2 (Myc-DDK-tagged)-Human metastasis associated 1 family, member 2 (MTA2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of MTA2 (mGFP-tagged)-Human metastasis associated 1 family, member 2 (MTA2)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MTA2 (mGFP-tagged)-Human metastasis associated 1 family, member 2 (MTA2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
MTA2 (untagged)-Human metastasis associated 1 family, member 2 (MTA2)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti-ORF clone of MTA2 (Myc-DDK-tagged)-Human metastasis associated 1 family, member 2 (MTA2)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal MTA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MTA2 antibody: human MTA2 (Human Metastasis associated 1 family, member 2), using a recombinant protein. |
Lenti-ORF clone of MTA2 (mGFP-tagged)-Human metastasis associated 1 family, member 2 (MTA2)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal PID/MTA2 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This PID/MTA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 516-544 amino acids from the C-terminal region of human PID/MTA2. |
Rabbit Polyclonal PID Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PID antibody was raised against a synthetic peptide corresponding to amino acids 652 to 668 of human PID (6), which differ from the mouse sequence by one amino acid (7) . |
Rabbit Polyclonal Anti-MTA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MTA2 antibody: synthetic peptide directed towards the N terminal of human MTA2. Synthetic peptide located within the following region: NGNVEAKVVCLFRRRDISSSLNSLADSNAREFEEESKQPGVSEQQRHQLK |
Rabbit Polyclonal Anti-MTA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MTA2 antibody: synthetic peptide directed towards the middle region of human MTA2. Synthetic peptide located within the following region: WKKYGGLKTPTQLEGATRGTTEPHSRGHLSRPEAQSLSPYTTSANRAKLL |
Rabbit Polyclonal Anti-MTA2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MTA2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AWGPPNMQCRLCASCWIYWKKYGGLKTPTQLEGAARGTTEPHSRGHLSRP |
Rabbit Polyclonal Anti-Mta2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Mta2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YSLVFDPVQKTLLADQGEIRVGCKFQAEIPDRLAEGESDNRNQQKMEMKV |
Rabbit Polyclonal Anti-MTA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MTA2 antibody: synthetic peptide directed towards the C terminal of human MTA2. Synthetic peptide located within the following region: DAPNPVVFVATKDTRALRKALTHLEMRRAARRPNLPLKVKPTLIAVRPPV |
Rabbit anti PKC (pS345) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the epitope -EDR-S-KSAP- with a phosphorylated Ser 345 of human PKC. |
Rabbit anti PID/MTA2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the C-terminus of human p38 protein |
Transient overexpression of MTA2 (NM_004739) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MTA2 (NM_004739) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MTA2 (NM_004739) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- MTA2
Families
- Druggable Genome