NLRP1 (Myc-DDK-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
NLRP1 (Myc-DDK-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 1,950.00
3 Weeks
Lenti ORF particles, NLRP1 (Myc-DDK tagged) - Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 1,950.00
6 Weeks
Lenti ORF particles, NLRP1 (mGFP-tagged) - Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
NLRP1 (Myc-DDK-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
NLRP1 (GFP-tagged) - Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
NLRP1 (GFP-tagged) - Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 5, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,840.00
6 Weeks
Lenti ORF particles, NLRP1 (Myc-DDK tagged) - Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 5, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 5, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,840.00
6 Weeks
Lenti ORF particles, NLRP1 (mGFP-tagged) - Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 5, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
NLRP1 (Myc-DDK-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of NLRP1 (Myc-DDK-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 4
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,870.00
9 Weeks
Lenti ORF particles, NLRP1 (Myc-DDK-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of NLRP1 (mGFP-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 4
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,870.00
9 Weeks
Lenti ORF particles, NLRP1 (mGFP-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,950.00
5 Weeks
Lenti ORF particles, NLRP1 (Myc-DDK tagged) - Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,950.00
7 Weeks
Lenti ORF particles, NLRP1 (mGFP-tagged) - Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
NLRP1 (Myc-DDK-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of NLRP1 (Myc-DDK-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,900.00
9 Weeks
Lenti ORF particles, NLRP1 (Myc-DDK-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of NLRP1 (mGFP-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,900.00
9 Weeks
Lenti ORF particles, NLRP1 (mGFP-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
NLRP1 (Myc-DDK-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of NLRP1 (Myc-DDK-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,920.00
9 Weeks
Lenti ORF particles, NLRP1 (Myc-DDK-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of NLRP1 (mGFP-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,920.00
9 Weeks
Lenti ORF particles, NLRP1 (mGFP-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
NLRP1 (GFP-tagged) - Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
NLRP1 (GFP-tagged) - Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
NLRP1 (GFP-tagged) - Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
NLRP1 (untagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Transient overexpression lysate of NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
NLRP1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal NALP1 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | NALP1 antibody was raised against a peptide corresponding to 13 amino acids near the carboxy-terminus of human NALP1. |
Rabbit Polyclonal Anti-NLRP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NLRP1 antibody: synthetic peptide directed towards the N terminal of human NLRP1. Synthetic peptide located within the following region: DTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCREL |
NLRP1 MS Standard C13 and N15-labeled recombinant protein (NP_127497)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
NLRP1 (untagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 5
Vector | pCMV6 series |
Tag | Tag Free |
NLRP1 (untagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
NLRP1 (untagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 2
Vector | pCMV6 series |
Tag | Tag Free |
NLRP1 (untagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 4
Vector | pCMV6 series |
Tag | Tag Free |
Transient overexpression of NLRP1 (NM_001033053) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NLRP1 (NM_033007) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NLRP1 (NM_033004) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NLRP1 (NM_014922) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NLRP1 (NM_033006) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NLRP1 (NM_001033053) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack