Products

View as table Download

NLRP1 (Myc-DDK-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, NLRP1 (Myc-DDK tagged) - Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, NLRP1 (mGFP-tagged) - Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

NLRP1 (Myc-DDK-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

NLRP1 (GFP-tagged) - Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

NLRP1 (GFP-tagged) - Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 5, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, NLRP1 (Myc-DDK tagged) - Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 5, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, NLRP1 (mGFP-tagged) - Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

NLRP1 (Myc-DDK-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of NLRP1 (Myc-DDK-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, NLRP1 (Myc-DDK-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of NLRP1 (mGFP-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, NLRP1 (mGFP-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, NLRP1 (Myc-DDK tagged) - Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, NLRP1 (mGFP-tagged) - Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

NLRP1 (Myc-DDK-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of NLRP1 (Myc-DDK-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, NLRP1 (Myc-DDK-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of NLRP1 (mGFP-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, NLRP1 (mGFP-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

NLRP1 (Myc-DDK-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of NLRP1 (Myc-DDK-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, NLRP1 (Myc-DDK-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of NLRP1 (mGFP-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, NLRP1 (mGFP-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

NLRP1 (GFP-tagged) - Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

NLRP1 (GFP-tagged) - Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

NLRP1 (GFP-tagged) - Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

NLRP1 (untagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF clone of Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Transient overexpression lysate of NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Lenti ORF clone of Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

NLRP1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal NALP1 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen NALP1 antibody was raised against a peptide corresponding to 13 amino acids near the carboxy-terminus of human NALP1.

Rabbit Polyclonal Anti-NLRP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NLRP1 antibody: synthetic peptide directed towards the N terminal of human NLRP1. Synthetic peptide located within the following region: DTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCREL

NLRP1 MS Standard C13 and N15-labeled recombinant protein (NP_127497)

Tag C-Myc/DDK
Expression Host HEK293

NLRP1 (untagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 5

Vector pCMV6 series
Tag Tag Free

NLRP1 (untagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 3

Vector pCMV6 series
Tag Tag Free

NLRP1 (untagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 2

Vector pCMV6 series
Tag Tag Free

NLRP1 (untagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 4

Vector pCMV6 series
Tag Tag Free

Transient overexpression of NLRP1 (NM_001033053) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of NLRP1 (NM_033007) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of NLRP1 (NM_033004) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of NLRP1 (NM_014922) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of NLRP1 (NM_033006) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of NLRP1 (NM_001033053) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack