Products

cDNA Clones (44)
Proteins (15)
Antibodies (7)
RNAi (3)
Gene Expression (2)
Jump to Filters
View as table Download
NALP1 (NLRP1) (NM_033004) Human Tagged ORF Clone
RC216481

USD 1,550.00

In Stock

NLRP1 (Myc-DDK-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
NALP1 (NLRP1) (NM_033004) Human Tagged ORF Clone Lentiviral Particle
RC216481L1V

USD 1,950.00

3 Weeks

Lenti ORF particles, NLRP1 (Myc-DDK tagged) - Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
NALP1 (NLRP1) (NM_033004) Human Tagged ORF Clone Lentiviral Particle
RC216481L2V

USD 1,950.00

6 Weeks

Lenti ORF particles, NLRP1 (mGFP-tagged) - Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
NALP1 (NLRP1) (NM_001033053) Human Tagged ORF Clone
RC208497

USD 1,440.00

In Stock

NLRP1 (Myc-DDK-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
NALP1 (NLRP1) (NM_001033053) Human Tagged ORF Clone
RG208497

USD 1,580.00

In Stock

NLRP1 (GFP-tagged) - Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NALP1 (NLRP1) (NM_033004) Human Tagged ORF Clone
RG216481

USD 1,710.00

In Stock

NLRP1 (GFP-tagged) - Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NALP1 (NLRP1) (NM_001033053) Human Tagged ORF Clone
RC208497L3

USD 1,640.00

3 Weeks

Lenti ORF clone of Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 5, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NALP1 (NLRP1) (NM_001033053) Human Tagged ORF Clone Lentiviral Particle
RC208497L3V

USD 1,840.00

6 Weeks

Lenti ORF particles, NLRP1 (Myc-DDK tagged) - Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NALP1 (NLRP1) (NM_001033053) Human Tagged ORF Clone
RC208497L4

USD 1,640.00

3 Weeks

Lenti ORF clone of Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 5, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NALP1 (NLRP1) (NM_001033053) Human Tagged ORF Clone Lentiviral Particle
RC208497L4V

USD 1,840.00

6 Weeks

Lenti ORF particles, NLRP1 (mGFP-tagged) - Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NALP1 (NLRP1) (NM_033007) Human Tagged ORF Clone
RC215205

USD 1,470.00

6 Weeks

NLRP1 (Myc-DDK-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
NALP1 (NLRP1) (NM_033007) Human Tagged ORF Clone
RC215205L3

USD 1,670.00

6 Weeks

Lenti-ORF clone of NLRP1 (Myc-DDK-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NALP1 (NLRP1) (NM_033007) Human Tagged ORF Clone Lentiviral Particle
RC215205L3V

USD 1,870.00

9 Weeks

Lenti ORF particles, NLRP1 (Myc-DDK-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NALP1 (NLRP1) (NM_033007) Human Tagged ORF Clone
RC215205L4

USD 1,670.00

6 Weeks

Lenti-ORF clone of NLRP1 (mGFP-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NALP1 (NLRP1) (NM_033007) Human Tagged ORF Clone Lentiviral Particle
RC215205L4V

USD 1,870.00

9 Weeks

Lenti ORF particles, NLRP1 (mGFP-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NALP1 (NLRP1) (NM_033004) Human Tagged ORF Clone
RC216481L3

USD 1,750.00

3 Weeks

Lenti ORF clone of Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NALP1 (NLRP1) (NM_033004) Human Tagged ORF Clone Lentiviral Particle
RC216481L3V

USD 1,950.00

5 Weeks

Lenti ORF particles, NLRP1 (Myc-DDK tagged) - Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NALP1 (NLRP1) (NM_033004) Human Tagged ORF Clone
RC216481L4

USD 1,750.00

3 Weeks

Lenti ORF clone of Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NALP1 (NLRP1) (NM_033004) Human Tagged ORF Clone Lentiviral Particle
RC216481L4V

USD 1,950.00

7 Weeks

Lenti ORF particles, NLRP1 (mGFP-tagged) - Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NALP1 (NLRP1) (NM_014922) Human Tagged ORF Clone
RC216538

USD 1,500.00

6 Weeks

NLRP1 (Myc-DDK-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
NALP1 (NLRP1) (NM_014922) Human Tagged ORF Clone
RC216538L3

USD 1,700.00

6 Weeks

Lenti-ORF clone of NLRP1 (Myc-DDK-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NALP1 (NLRP1) (NM_014922) Human Tagged ORF Clone Lentiviral Particle
RC216538L3V

USD 1,900.00

9 Weeks

Lenti ORF particles, NLRP1 (Myc-DDK-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NALP1 (NLRP1) (NM_014922) Human Tagged ORF Clone
RC216538L4

USD 1,700.00

6 Weeks

Lenti-ORF clone of NLRP1 (mGFP-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NALP1 (NLRP1) (NM_014922) Human Tagged ORF Clone Lentiviral Particle
RC216538L4V

USD 1,900.00

9 Weeks

Lenti ORF particles, NLRP1 (mGFP-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NALP1 (NLRP1) (NM_033006) Human Tagged ORF Clone
RC223646

USD 1,520.00

6 Weeks

NLRP1 (Myc-DDK-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
NALP1 (NLRP1) (NM_033006) Human Tagged ORF Clone
RC223646L3

USD 1,720.00

6 Weeks

Lenti-ORF clone of NLRP1 (Myc-DDK-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NALP1 (NLRP1) (NM_033006) Human Tagged ORF Clone Lentiviral Particle
RC223646L3V

USD 1,920.00

9 Weeks

Lenti ORF particles, NLRP1 (Myc-DDK-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NALP1 (NLRP1) (NM_033006) Human Tagged ORF Clone
RC223646L4

USD 1,720.00

6 Weeks

Lenti-ORF clone of NLRP1 (mGFP-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NALP1 (NLRP1) (NM_033006) Human Tagged ORF Clone Lentiviral Particle
RC223646L4V

USD 1,920.00

9 Weeks

Lenti ORF particles, NLRP1 (mGFP-tagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NALP1 (NLRP1) (NM_033007) Human Tagged ORF Clone
RG215205

USD 1,620.00

7 Weeks

NLRP1 (GFP-tagged) - Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NALP1 (NLRP1) (NM_014922) Human Tagged ORF Clone
RG216538

USD 1,650.00

7 Weeks

NLRP1 (GFP-tagged) - Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NALP1 (NLRP1) (NM_033006) Human Tagged ORF Clone
RG223646

USD 1,670.00

7 Weeks

NLRP1 (GFP-tagged) - Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NALP1 (NLRP1) (NM_033004) Human Untagged Clone
SC308738

USD 2,990.00

In Stock

NLRP1 (untagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
NALP1 (NLRP1) Human qPCR Primer Pair (NM_033004)
HP229114

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene NLRP1

NALP1 (NLRP1) (NM_033004) Human Tagged ORF Clone
RC216481L1

USD 2,160.00

In Stock

Lenti ORF clone of Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
NALP1 (NLRP1) Rabbit Polyclonal Antibody
TA371700

USD 380.00

4 Weeks

NLRP1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human NLRP1
NALP1 (NLRP1) (NM_033004) Human Over-expression Lysate
LY409802

USD 605.00

In Stock

Transient overexpression lysate of NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NALP1 (NLRP1) (NM_033004) Human Tagged ORF Clone
RC216481L2

USD 1,750.00

3 Weeks

Lenti ORF clone of Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
NALP1 (NLRP1) Human shRNA Lentiviral Particle (Locus ID 22861)
TL303052V

USD 1,617.00

5 Weeks

NALP1 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti
NALP1 (NLRP1) (NM_033004) Human Over-expression Lysate
LC409802

USD 187.00

In Stock

NLRP1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NALP1 (NLRP1) Rabbit Polyclonal Antibody
TA306106

USD 430.00

5 Days

Rabbit Polyclonal NALP1 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen NALP1 antibody was raised against a peptide corresponding to 13 amino acids near the carboxy-terminus of human NALP1.
NALP1 (NLRP1) Rabbit Polyclonal Antibody
TA334965

USD 375.00

5 Days

Rabbit Polyclonal Anti-NLRP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NLRP1 antibody: synthetic peptide directed towards the N terminal of human NLRP1. Synthetic peptide located within the following region: DTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCREL
Human NALP1 (NLRP1) activation kit by CRISPRa
GA107860

USD 1,290.00

2 Weeks

NLRP1 CRISPRa kit - CRISPR gene activation of human NLR family pyrin domain containing 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
NALP1 (NLRP1) (NM_033004) Human Mass Spec Standard
PH316481

USD 2,055.00

3 Weeks

NLRP1 MS Standard C13 and N15-labeled recombinant protein (NP_127497)

Tag C-Myc/DDK
Expression Host HEK293
NALP1 (NLRP1) (NM_001033053) Human 3' UTR Clone
SC205602

USD 560.00

4 Weeks

3`UTR clone of NLR family pyrin domain containing 1 (NLRP1) transcript variant 5 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
NALP1 (NLRP1) (NM_033007) Human 3' UTR Clone
SC208439

USD 560.00

4 Weeks

3`UTR clone of NLR family pyrin domain containing 1 (NLRP1) transcript variant 4 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
NALP1 (NLRP1) (NM_014922) Human 3' UTR Clone
SC208440

USD 560.00

4 Weeks

3`UTR clone of NLR family pyrin domain containing 1 (NLRP1) transcript variant 2 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
NALP1 (NLRP1) (NM_033004) Human 3' UTR Clone
SC208441

USD 560.00

4 Weeks

3`UTR clone of NLR family pyrin domain containing 1 (NLRP1) transcript variant 1 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
NALP1 (NLRP1) (NM_033006) Human 3' UTR Clone
SC208443

USD 560.00

4 Weeks

3`UTR clone of NLR family pyrin domain containing 1 (NLRP1) transcript variant 3 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
NALP1 (NLRP1) (NM_001033053) Human Untagged Clone
SC302688

USD 1,100.00

2 Weeks

NLRP1 (untagged)-Human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 5

Vector pCMV6 series
Tag Tag Free