Products

cDNA Clones (29)
Proteins (12)
Antibodies (3)
Jump to Filters
View as table Download
PDE1C (NM_005020) Human Tagged ORF Clone
RC205291

USD 98.00

USD 780.00

In Stock

PDE1C (Myc-DDK-tagged)-Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PDE1C (NM_005020) Human Tagged ORF Clone Lentiviral Particle
RC205291L1V

USD 820.00

3 Weeks

Lenti ORF particles, PDE1C (Myc-DDK tagged) - Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PDE1C (NM_005020) Human Tagged ORF Clone Lentiviral Particle
RC205291L2V

USD 820.00

6 Weeks

Lenti ORF particles, PDE1C (mGFP-tagged) - Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PDE1C (NM_001191056) Human Tagged ORF Clone
RC233033

USD 670.00

3 Weeks

PDE1C (Myc-DDK tagged) - Homo sapiens phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PDE1C (NM_005020) Human Tagged ORF Clone
RG205291

USD 460.00

In Stock

PDE1C (GFP-tagged) - Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PDE1C (NM_005020) Human Tagged ORF Clone
RC205291L3

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 4, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE1C (NM_005020) Human Tagged ORF Clone Lentiviral Particle
RC205291L3V

USD 820.00

5 Weeks

Lenti ORF particles, PDE1C (Myc-DDK tagged) - Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE1C (NM_005020) Human Tagged ORF Clone
RC205291L4

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 4, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE1C (NM_005020) Human Tagged ORF Clone Lentiviral Particle
RC205291L4V

USD 820.00

7 Weeks

Lenti ORF particles, PDE1C (mGFP-tagged) - Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE1C (NM_001191057) Human Tagged ORF Clone
RC231386

USD 610.00

4 Weeks

PDE1C (Myc-DDK-tagged)-Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PDE1C (NM_001191057) Human Tagged ORF Clone
RC231386L3

USD 810.00

4 Weeks

Lenti-ORF clone of PDE1C (Myc-DDK-tagged)-Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE1C (NM_001191057) Human Tagged ORF Clone Lentiviral Particle
RC231386L3V

USD 1,010.00

7 Weeks

Lenti ORF particles, PDE1C (Myc-DDK-tagged)-Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE1C (NM_001191057) Human Tagged ORF Clone
RC231386L4

USD 810.00

4 Weeks

Lenti-ORF clone of PDE1C (mGFP-tagged)-Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE1C (NM_001191057) Human Tagged ORF Clone Lentiviral Particle
RC231386L4V

USD 1,010.00

7 Weeks

Lenti ORF particles, PDE1C (mGFP-tagged)-Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE1C (NM_001191058) Human Tagged ORF Clone
RC231408

USD 860.00

4 Weeks

PDE1C (Myc-DDK-tagged)-Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PDE1C (NM_001191058) Human Tagged ORF Clone
RC231408L3

USD 1,060.00

4 Weeks

Lenti-ORF clone of PDE1C (Myc-DDK-tagged)-Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE1C (NM_001191058) Human Tagged ORF Clone Lentiviral Particle
RC231408L3V

USD 1,260.00

7 Weeks

Lenti ORF particles, PDE1C (Myc-DDK-tagged)-Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE1C (NM_001191058) Human Tagged ORF Clone
RC231408L4

USD 1,060.00

4 Weeks

Lenti-ORF clone of PDE1C (mGFP-tagged)-Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE1C (NM_001191058) Human Tagged ORF Clone Lentiviral Particle
RC231408L4V

USD 1,260.00

7 Weeks

Lenti ORF particles, PDE1C (mGFP-tagged)-Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE1C (NM_001191059) Human Tagged ORF Clone
RC233095

USD 610.00

4 Weeks

PDE1C (Myc-DDK tagged) - Homo sapiens phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PDE1C (NM_001191057) Human Tagged ORF Clone
RG231386

USD 670.00

5 Weeks

PDE1C (GFP-tagged) - Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PDE1C (NM_001191058) Human Tagged ORF Clone
RG231408

USD 950.00

5 Weeks

PDE1C (GFP-tagged) - Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PDE1C (NM_001191056) Human Tagged ORF Clone
RG233033

USD 740.00

3 Weeks

PDE1C (GFP-tagged) - Homo sapiens phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PDE1C (NM_001191059) Human Tagged ORF Clone
RG233095

USD 670.00

4 Weeks

PDE1C (GFP-tagged) - Homo sapiens phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PDE1C (NM_005020) Human Recombinant Protein
TP760557

USD 215.00

In Stock

Purified recombinant protein of Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 4, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
PDE1C (NM_005020) Human Tagged Lenti ORF Clone
RC205291L1

USD 768.00

In Stock

Lenti ORF clone of Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 4, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PDE1C (NM_005020) Human Tagged ORF Clone
RC205291L2

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 4, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PDE1C (NM_005020) Human Untagged Clone
SC124021

USD 1,070.00

In Stock

PDE1C (untagged)-Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 4

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
SC124021 is the updated version of SC117013.
PDE1C Rabbit Polyclonal Antibody
TA317146

USD 425.00

5 Days

Phosphodiesterase 1c / PDE1C Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Bat, Bovine, Hamster, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Gorilla, Dog, Horse, Gibbon
Conjugation Unconjugated
Immunogen PDE1C antibody was raised against synthetic 16 amino acid peptide from C-terminus of human PDE1C. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Elephant, Panda, Horse, Rabbit (100%); Opossum (88%).
PDE1C Rabbit Polyclonal Antibody
TA335728

USD 375.00

5 Days

Rabbit Polyclonal Anti-PDE1C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PDE1C Antibody: synthetic peptide directed towards the N terminal of human PDE1C. Synthetic peptide located within the following region: DLKKNIEYAASVLEAVYIDETRRLLDTEDELSDIQTDSVPSEVRDWLAST
PDE1C Rabbit Polyclonal Antibody
TA342232

USD 375.00

5 Days

Rabbit polyclonal Anti-PDE1C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDE1C antibody: synthetic peptide directed towards the middle region of human PDE1C. Synthetic peptide located within the following region: IDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKR
PDE1C (NM_001191056) Human Untagged Clone
SC329424

USD 650.00

3 Weeks

PDE1C (untagged) - Homo sapiens phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 1

Vector pCMV6 series
Tag Tag Free
PDE1C (NM_001191059) Human Untagged Clone
SC329425

USD 720.00

4 Weeks

PDE1C (untagged) - Homo sapiens phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 5

Vector pCMV6 series
Tag Tag Free
PDE1C ICC Control Block
TB405291

USD 1,430.00

4 Weeks

Transient overexpression of PDE1C (NM_005020) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PDE1C ICC Control Block
TB431386

USD 1,260.00

4 Weeks

Transient overexpression of PDE1C (NM_001191057) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PDE1C ICC Control Block
TB431408

USD 1,510.00

4 Weeks

Transient overexpression of PDE1C (NM_001191058) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PDE1C ICC Control Block
TB433033

USD 1,320.00

4 Weeks

Transient overexpression of PDE1C (NM_001191056) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PDE1C ICC Control Block
TB433095

USD 1,260.00

4 Weeks

Transient overexpression of PDE1C (NM_001191059) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PDE1C Cytosection
TS405291

USD 225.00

4 Weeks

Transient overexpression of PDE1C (NM_005020) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PDE1C Cytosection
TS405291P5

USD 889.00

4 Weeks

Transient overexpression of PDE1C (NM_005020) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

PDE1C ICC Control Sections
TS431386P5

USD 889.00

4 Weeks

Transient overexpression of PDE1C (NM_001191057) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

PDE1C ICC Control Sections
TS431408P5

USD 889.00

4 Weeks

Transient overexpression of PDE1C (NM_001191058) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

PDE1C ICC Control Sections
TS433033P5

USD 889.00

4 Weeks

Transient overexpression of PDE1C (NM_001191056) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

PDE1C ICC Control Sections
TS433095P5

USD 889.00

4 Weeks

Transient overexpression of PDE1C (NM_001191059) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack