PIM2 (Myc-DDK-tagged)-Human pim-2 oncogene (PIM2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PIM2 (Myc-DDK-tagged)-Human pim-2 oncogene (PIM2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human pim-2 oncogene (PIM2)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
PIM2 (GFP-tagged) - Human pim-2 oncogene (PIM2)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, PIM2 (Myc-DDK tagged) - Human pim-2 oncogene (PIM2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, PIM2 (mGFP-tagged) - Human pim-2 oncogene (PIM2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
PIM2 (untagged)-Human pim-2 oncogene (PIM2)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human pim-2 oncogene (PIM2), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PIM2 (Myc-DDK tagged) - Human pim-2 oncogene (PIM2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PIM2 (mGFP-tagged) - Human pim-2 oncogene (PIM2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human pim-2 oncogene (PIM2), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human pim-2 oncogene (PIM2), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human pim-2 oncogene (PIM2), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Transient overexpression lysate of pim-2 oncogene (PIM2)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PIM2 (untagged)-Kinase deficient mutant (K61M) of Human pim-2 oncogene (PIM2)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
PIM2 Antibody (C-term ) Rabbit Polyclonal Antibody (Pab)
Applications | IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This PIM2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 277-308 amino acids from the C-terminal region of human PIM2. |
PIM2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal antibody to PIM2 (pim-2 oncogene)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 53 and 278 of PIM2 (Uniprot ID#Q9P1W9) |
Rabbit Polyclonal Anti-PIM2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PIM2 antibody: synthetic peptide directed towards the middle region of human PIM2. Synthetic peptide located within the following region: LRRGCAKLIDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVW |
PIM2 (1-311, His-tag) human recombinant protein, 0.25 mg
Tag | His-tag |
Expression Host | E. coli |
PIM2 (1-311, His-tag) human recombinant protein, 50 µg
Tag | His-tag |
Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) PIM2 mouse monoclonal antibody, clone OTI8G10 (formerly 8G10)
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PIM2 mouse monoclonal antibody, clone OTI5B5 (formerly 5B5)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PIM2 mouse monoclonal antibody, clone OTI8B4 (formerly 8B4)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PIM2 mouse monoclonal antibody, clone OTI5D5 (formerly 5D5)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PIM2 mouse monoclonal antibody, clone OTI10A12 (formerly 10A12)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PIM2 mouse monoclonal antibody, clone OTI8H10 (formerly 8H10)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PIM2 mouse monoclonal antibody, clone OTI9A5 (formerly 9A5)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PIM2 MS Standard C13 and N15-labeled recombinant protein (NP_006866)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Rabbit Polyclonal Anti-PIM2 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PIM2 |
Anti-PIM2 mouse monoclonal antibody, clone OTI8G10 (formerly 8G10)
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PIM2 mouse monoclonal antibody, clone 8G10, Biotinylated
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PIM2 mouse monoclonal antibody, clone 8G10, HRP conjugated
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-PIM2 mouse monoclonal antibody, clone OTI8G10 (formerly 8G10)
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PIM2 mouse monoclonal antibody, clone OTI5B5 (formerly 5B5)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PIM2 mouse monoclonal antibody, clone OTI5B5 (formerly 5B5), Biotinylated
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PIM2 mouse monoclonal antibody, clone OTI5B5 (formerly 5B5), HRP conjugated
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PIM2 mouse monoclonal antibody, clone OTI5B5 (formerly 5B5)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-PIM2 mouse monoclonal antibody, clone OTI8B4 (formerly 8B4)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-PIM2 mouse monoclonal antibody, clone OTI8B4 (formerly 8B4), Biotinylated
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Anti-PIM2 mouse monoclonal antibody, clone OTI8B4 (formerly 8B4), HRP conjugated
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-PIM2 mouse monoclonal antibody, clone OTI8B4 (formerly 8B4)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-PIM2 mouse monoclonal antibody, clone OTI5D5 (formerly 5D5)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-PIM2 mouse monoclonal antibody, clone OTI5D5 (formerly 5D5), Biotinylated
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Anti-PIM2 mouse monoclonal antibody, clone OTI5D5 (formerly 5D5), HRP conjugated
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-PIM2 mouse monoclonal antibody, clone OTI5D5 (formerly 5D5)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-PIM2 mouse monoclonal antibody, clone OTI10A12 (formerly 10A12)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-PIM2 mouse monoclonal antibody, clone OTI10A12 (formerly 10A12), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Anti-PIM2 mouse monoclonal antibody, clone OTI10A12 (formerly 10A12), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-PIM2 mouse monoclonal antibody, clone OTI10A12 (formerly 10A12)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-PIM2 mouse monoclonal antibody, clone OTI8H10 (formerly 8H10)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |