Germany
Japan
United Kingdom
China
PRPS2 (Myc-DDK-tagged)-Human phosphoribosyl pyrophosphate synthetase 2 (PRPS2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
PRPS2 (Myc-DDK-tagged)-Human phosphoribosyl pyrophosphate synthetase 2 (PRPS2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human phosphoribosyl pyrophosphate synthetase 2 (PRPS2), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PRPS2 (Myc-DDK tagged) - Human phosphoribosyl pyrophosphate synthetase 2 (PRPS2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human phosphoribosyl pyrophosphate synthetase 2 (PRPS2), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PRPS2 (mGFP-tagged) - Human phosphoribosyl pyrophosphate synthetase 2 (PRPS2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human phosphoribosyl pyrophosphate synthetase 2 (PRPS2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PRPS2 (Myc-DDK tagged) - Human phosphoribosyl pyrophosphate synthetase 2 (PRPS2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human phosphoribosyl pyrophosphate synthetase 2 (PRPS2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PRPS2 (mGFP-tagged) - Human phosphoribosyl pyrophosphate synthetase 2 (PRPS2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PRPS2 (GFP-tagged) - Human phosphoribosyl pyrophosphate synthetase 2 (PRPS2), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PRPS2 (GFP-tagged) - Human phosphoribosyl pyrophosphate synthetase 2 (PRPS2), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal Anti-PRPS2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRPS2 antibody: synthetic peptide directed towards the middle region of human PRPS2. Synthetic peptide located within the following region: VSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAI |
Rabbit polyclonal antibody to PRPS2 (phosphoribosyl pyrophosphate synthetase 2)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 243 of PRPS2 (Uniprot ID#P11908) |
PRPS2 (untagged)-Human phosphoribosyl pyrophosphate synthetase 2 (PRPS2), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-PRPS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRPS2 antibody: synthetic peptide directed towards the N terminal of human PRPS2. Synthetic peptide located within the following region: PNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRGE |
Rabbit Polyclonal Anti-PRPS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRPS2 antibody: synthetic peptide directed towards the N terminal of human PRPS2. Synthetic peptide located within the following region: MPNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRG |
Rabbit Polyclonal Anti-PRPS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRPS2 antibody: synthetic peptide directed towards the middle region of human PRPS2. Synthetic peptide located within the following region: ENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMV |
PRPS2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PRPS2 (1-321, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
PRPS2 (1-321, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
PRPS2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of phosphoribosyl pyrophosphate synthetase 2 (PRPS2), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Transient overexpression lysate of phosphoribosyl pyrophosphate synthetase 2 (PRPS2), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
PRPS2 MS Standard C13 and N15-labeled recombinant protein (NP_001034180)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
PRPS2 (untagged)-Human phosphoribosyl pyrophosphate synthetase 2 (PRPS2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of PRPS2 (NM_002765) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PRPS2 (NM_001039091) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PRPS2 (NM_002765) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PRPS2 (NM_002765) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PRPS2 (NM_001039091) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PRPS2 (NM_001039091) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PRPS2
Families
- Druggable Genome