Germany
Japan
United Kingdom
China
RAB5A (Myc-DDK-tagged)-Human RAB5A, member RAS oncogene family (RAB5A)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
RAB5A (GFP-tagged) - Human RAB5A, member RAS oncogene family (RAB5A)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Recombinant protein of human RAB5A, member RAS oncogene family (RAB5A)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, RAB5A (Myc-DDK tagged) - Human RAB5A, member RAS oncogene family (RAB5A), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, RAB5A (mGFP-tagged) - Human RAB5A, member RAS oncogene family (RAB5A), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF clone of Human RAB5A, member RAS oncogene family (RAB5A), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human RAB5A, member RAS oncogene family (RAB5A), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
RAB5A (myc-DDK-tagged) - Human RAB5A, member RAS oncogene family (RAB5A), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
RAB5A (untagged)-Human RAB5A, member RAS oncogene family (RAB5A)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human RAB5A, member RAS oncogene family (RAB5A), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
RAB5A HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
USD 1,020.00
5 Weeks
Lenti ORF particles, RAB5A (Myc-DDK tagged) - Human RAB5A, member RAS oncogene family (RAB5A), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 1,020.00
6 Weeks
Lenti ORF particles, RAB5A (mGFP-tagged) - Human RAB5A, member RAS oncogene family (RAB5A), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit polyclonal Rab5 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Rab5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 182-211 amino acids from the C-terminal region of human Rab5. |
Rabbit Polyclonal Anti-Rab5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rab5 Antibody: Peptide sequence around aa.188~192( N-P-G-A-N) derived from Human Rab5. |
Rabbit Polyclonal Anti-Rab5A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rab5A Antibody: A synthesized peptide derived from human Rab5A |
Goat Polyclonal Anti-Rab5a Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 115 aa to the C-terminus of mouse Rab5a produced in E. coli. |
Lenti ORF clone of Human RAB5A, member RAS oncogene family (RAB5A), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
RAB5A (untagged)-Human RAB5A, member RAS oncogene family (RAB5A)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of RAB5A, member RAS oncogene family (RAB5A)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal Anti-RAB5A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB5A antibody: synthetic peptide directed towards the middle region of human RAB5A. Synthetic peptide located within the following region: KTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCS |
Rabbit polyclonal Rab4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat. Not yet tested on other species |
| Conjugation | Unconjugated |
| Immunogen | C-terminal peptide from human Rab4 |
Rabbit polyclonal Anti-RAB5A Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB5A antibody: synthetic peptide directed towards the middle region of human RAB5A. Synthetic peptide located within the following region: SFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNS |
RAB5A / RAB5 (1-215) human recombinant protein, 0.5 mg
| Expression Host | E. coli |
RAB5A / RAB5 (1-215) human recombinant protein, 0.1 mg
| Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) RAB5A mouse monoclonal antibody,clone OTI6D9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RAB5A MS Standard C13 and N15-labeled recombinant protein (NP_004153)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
RAB5A (GFP-tagged) - Human RAB5A, member RAS oncogene family (RAB5A), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
RAB5A (untagged) - Human RAB5A, member RAS oncogene family (RAB5A), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Anti-RAB5A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1-16 amino acids of Human Ras-related protein Rab-5A |
Anti-RAB5A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1-16 amino acids of Human Ras-related protein Rab-5A |
RAB5A mouse monoclonal antibody,clone OTI6D9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
RAB5A mouse monoclonal antibody,clone OTI6D9, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
RAB5A mouse monoclonal antibody,clone OTI6D9, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
RAB5A mouse monoclonal antibody,clone OTI6D9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Transient overexpression of RAB5A (NM_004162) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RAB5A (NM_001292048) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RAB5A (NM_004162) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of RAB5A (NM_004162) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of RAB5A (NM_001292048) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- RAB5A
Families
- Druggable Genome