RAD21 (Myc-DDK-tagged)-Human RAD21 homolog (S. pombe) (RAD21)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RAD21 (Myc-DDK-tagged)-Human RAD21 homolog (S. pombe) (RAD21)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, RAD21 (Myc-DDK tagged) - Human RAD21 homolog (S. pombe) (RAD21), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, RAD21 (mGFP-tagged) - Human RAD21 homolog (S. pombe) (RAD21), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
RAD21 (GFP-tagged) - Human RAD21 homolog (S. pombe) (RAD21)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human RAD21 homolog (S. pombe) (RAD21), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, RAD21 (Myc-DDK tagged) - Human RAD21 homolog (S. pombe) (RAD21), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human RAD21 homolog (S. pombe) (RAD21), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, RAD21 (mGFP-tagged) - Human RAD21 homolog (S. pombe) (RAD21), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human RAD21 homolog (S. pombe) (RAD21), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
RAD21 (untagged)-Human RAD21 homolog (S. pombe) (RAD21)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human RAD21 homolog (S. pombe) (RAD21), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
RAD21 (untagged)-Human RAD21 homolog (S. pombe) (RAD21)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-RAD21 Antibody - C-terminal region
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Rad21 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: FSLPAQPLWNNRLLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKEFEN |
Rabbit Polyclonal Anti-RAD21 Antibody - N-terminal region
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Rad21 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: EDDDMLVSTSASNLLLEPEQSTSNLNEKINHLEYEDQYKDDNFGEGNDGG |
Rabbit polyclonal anti-RAD21 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RAD21. |
RAD21 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Transient overexpression lysate of RAD21 homolog (S. pombe) (RAD21)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Mouse Monoclonal Antibody against Cohesin / hRad21 (CM110-2C10)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RAD21 mouse monoclonal antibody,clone OTI11F10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RAD21 mouse monoclonal antibody,clone OTI2A12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RAD21 mouse monoclonal antibody,clone OTI6C10
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RAD21 mouse monoclonal antibody,clone OTI11F10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RAD21 mouse monoclonal antibody,clone OTI11F10, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
RAD21 mouse monoclonal antibody,clone OTI11F10, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RAD21 mouse monoclonal antibody,clone OTI11F10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RAD21 mouse monoclonal antibody,clone OTI2A12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RAD21 mouse monoclonal antibody,clone OTI2A12, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
RAD21 mouse monoclonal antibody,clone OTI2A12, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RAD21 mouse monoclonal antibody,clone OTI2A12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RAD21 mouse monoclonal antibody,clone OTI6C10
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RAD21 mouse monoclonal antibody,clone OTI6C10, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
RAD21 mouse monoclonal antibody,clone OTI6C10, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RAD21 mouse monoclonal antibody,clone OTI6C10
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of RAD21 (NM_006265) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RAD21 (NM_006265) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of RAD21 (NM_006265) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack