Products

cDNA Clones (26)
Antibodies (21)
RNAi (12)
Gene Expression (7)
Proteins (5)
Jump to Filters
View as table Download
RAD21 (NM_006265) Human Tagged ORF Clone
RC208262

USD 480.00

In Stock

RAD21 (Myc-DDK-tagged)-Human RAD21 homolog (S. pombe) (RAD21)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Rad21 (NM_009009) Mouse Tagged ORF Clone
MR215893

USD 670.00

In Stock

Rad21 (Myc-DDK-tagged) - Mouse RAD21 homolog (S. pombe) (Rad21)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RAD21 (NM_006265) Human Tagged ORF Clone Lentiviral Particle
RC208262L2V

USD 880.00

3 Weeks

Lenti ORF particles, RAD21 (mGFP-tagged) - Human RAD21 homolog (S. pombe) (RAD21), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Rad21 (NM_009009) Mouse Tagged ORF Clone
MG215893

USD 740.00

In Stock

Rad21 (GFP-tagged) - Mouse RAD21 homolog (S. pombe) (Rad21), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RAD21 (NM_006265) Human Tagged ORF Clone
RG208262

USD 530.00

In Stock

RAD21 (GFP-tagged) - Human RAD21 homolog (S. pombe) (RAD21)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RAD21 Human Gene Knockout Kit (CRISPR)
KN408262

USD 1,290.00

2 Weeks

RAD21 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN408262 is the updated version of KN208262.
Rad21 Mouse Gene Knockout Kit (CRISPR)
KN514409

USD 1,290.00

2 Weeks

Rad21 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN514409 is the updated version of KN314409.
Rad21 (NM_009009) Mouse Tagged ORF Clone
MR215893L3

USD 870.00

3 Weeks

Lenti ORF clone of Rad21 (Myc-DDK-tagged) - Mouse RAD21 homolog (S. pombe) (Rad21)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rad21 (NM_009009) Mouse Tagged ORF Clone
MR215893L4

USD 870.00

3 Weeks

Lenti ORF clone of Rad21 (mGFP-tagged) - Mouse RAD21 homolog (S. pombe) (Rad21)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Rad21 (NM_009009) Mouse Tagged ORF Clone Lentiviral Particle
MR215893L4V

USD 1,070.00

6 Weeks

Lenti ORF particles, Rad21 (GFP-tagged) - Mouse RAD21 homolog (S. pombe) (Rad21), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RAD21 (NM_006265) Human Tagged ORF Clone
RC208262L3

USD 680.00

3 Weeks

Lenti ORF clone of Human RAD21 homolog (S. pombe) (RAD21), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RAD21 (NM_006265) Human Tagged ORF Clone
RC208262L4

USD 680.00

In Stock

Lenti ORF clone of Human RAD21 homolog (S. pombe) (RAD21), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RAD21 (NM_006265) Human Tagged ORF Clone Lentiviral Particle
RC208262L4V

USD 880.00

3 Weeks

Lenti ORF particles, RAD21 (mGFP-tagged) - Human RAD21 homolog (S. pombe) (RAD21), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Rad21 (NM_001025701) Rat Tagged ORF Clone
RR214087

USD 870.00

5 Weeks

Rad21 (Myc-DDK-tagged ORF) - Rat RAD21 homolog (S. pombe) (Rad21), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Rad21 (NM_001025701) Rat Tagged ORF Clone
RR214087L3

USD 1,050.00

9 Weeks

Lenti ORF clone of Rad21 (Myc-DDK-tagged ORF) - Rat RAD21 homolog (S. pombe) (Rad21), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rad21 (NM_001025701) Rat Tagged ORF Clone
RR214087L4

USD 1,150.00

9 Weeks

Lenti ORF clone of Rad21 (mGFP-tagged ORF) - Rat RAD21 homolog (S. pombe) (Rad21), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Rad21 (NM_001025701) Rat Tagged ORF Clone Lentiviral Particle
RR214087L4V

USD 1,420.00

13 Weeks

Lenti ORF particles, Rad21 (GFP-tagged ORF) - Rat RAD21 homolog (S. pombe) (Rad21), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RAD21 (NM_006265) Human Tagged Lenti ORF Clone
RC208262L2

USD 840.00

In Stock

Lenti ORF clone of Human RAD21 homolog (S. pombe) (RAD21), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
RAD21 (NM_006265) Human Untagged Clone
SC116225

USD 310.00

In Stock

RAD21 (untagged)-Human RAD21 homolog (S. pombe) (RAD21)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Rad21 Mouse shRNA Plasmid (Locus ID 19357)
TL501846

USD 815.00

In Stock

Rad21 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
RAD21 (NM_006265) Human Tagged ORF Clone
RC208262L1

USD 680.00

In Stock

Lenti ORF clone of Human RAD21 homolog (S. pombe) (RAD21), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
RAD21 (NM_006265) Human Untagged Clone
SC322657

USD 310.00

In Stock

RAD21 (untagged)-Human RAD21 homolog (S. pombe) (RAD21)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
RAD21 Rabbit Polyclonal Antibody
TA345136

USD 475.00

5 Days

Rabbit Polyclonal Anti-RAD21 Antibody - C-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Rad21 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: FSLPAQPLWNNRLLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKEFEN
RAD21 Rabbit Polyclonal Antibody
TA345137

USD 475.00

5 Days

Rabbit Polyclonal Anti-RAD21 Antibody - N-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Rad21 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: EDDDMLVSTSASNLLLEPEQSTSNLNEKINHLEYEDQYKDDNFGEGNDGG
Rad21 Mouse qPCR Primer Pair (NM_009009)
MP212373

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Rad21

RAD21 Rabbit Polyclonal Antibody
TA312306

USD 345.00

In Stock

Rabbit polyclonal anti-RAD21 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RAD21.
RAD21 Human shRNA Plasmid Kit (Locus ID 5885)
TL309968

USD 815.00

In Stock

RAD21 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
E. coli Selection Chloramphenicol
Mammalian Cell Selection Puromycin
RAD21 Human shRNA Plasmid Kit (Locus ID 5885)
TR309968

USD 715.00

In Stock

RAD21 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
E. coli Selection Ampicillin
Mammalian Cell Selection Puromycin
RAD21 Human qPCR Primer Pair (NM_006265)
HP209240

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene RAD21

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
RAD21 (NM_006265) Human Over-expression Lysate
LC401887

USD 121.00

In Stock

RAD21 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
RAD21 Human siRNA Oligo Duplex (Locus ID 5885)
SR303963

USD 430.00

In Stock

RAD21 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

RAD21 (NM_006265) Human Over-expression Lysate
LY401887

USD 396.00

5 Days

Transient overexpression lysate of RAD21 homolog (S. pombe) (RAD21)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
RAD21 Mouse Monoclonal Antibody [Clone ID: CM110-2C10]
TA301500

USD 424.00

5 Days

Mouse Monoclonal Antibody against Cohesin / hRad21 (CM110-2C10)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
RAD21 Mouse Monoclonal Antibody [Clone ID: OTI11F10]
CF811186

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RAD21 mouse monoclonal antibody,clone OTI11F10

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
RAD21 Mouse Monoclonal Antibody [Clone ID: OTI2A12]
CF811221

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RAD21 mouse monoclonal antibody,clone OTI2A12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
RAD21 Mouse Monoclonal Antibody [Clone ID: OTI6C10]
CF811222

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RAD21 mouse monoclonal antibody,clone OTI6C10

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Human RAD21 activation kit by CRISPRa
GA103998

USD 1,290.00

2 Weeks

RAD21 CRISPRa kit - CRISPR gene activation of human RAD21 cohesin complex component

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Rad21 activation kit by CRISPRa
GA203547

USD 1,290.00

2 Weeks

Rad21 CRISPRa kit - CRISPR gene activation of mouse RAD21 cohesin complex component

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
RAD21 Human qPCR Template Standard (NM_006265)
HK206127

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene RAD21

Application Plasmid of exact quantity for transcript copy number calculation
Rad21 (NM_009009) Mouse Untagged Clone
MC219906

USD 850.00

4 Weeks

Rad21 (untagged) - Mouse RAD21 homolog (S. pombe) (Rad21), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Rad21 (NM_001025701) Rat Untagged Clone
RN214087

USD 870.00

5 Weeks

Rad21 (untagged ORF) - Rat RAD21 homolog (S. pombe) (Rad21), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
RAD21 (NM_006265) Human 3' UTR Clone
SC215489

USD 670.00

4 Weeks

3`UTR clone of RAD21 homolog (S. pombe) (RAD21) for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
Rad21 Mouse siRNA Oligo Duplex (Locus ID 19357)
SR418489

USD 430.00

2 Weeks

Rad21 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Rad21 Rat siRNA Oligo Duplex (Locus ID 314949)
SR513797

USD 430.00

2 Weeks

Rad21 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

RAD21 Rabbit Polyclonal Antibody
TA380666

USD 220.00

3 Weeks

Rad21 Rabbit polyclonal Antibody

Applications ChIP, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human Rad21 .
RAD21 Rabbit Monoclonal Antibody [Clone ID: R03-5I0]
TA385117

USD 380.00

4 Weeks

Rad21 Rabbit monoclonal Antibody

Applications IF, IHC, WB
Reactivities Hamster, Human
Conjugation Unconjugated