Products

Proteins (13)
cDNA Clones (9)
Antibodies (8)
Jump to Filters
View as table Download
14-3-3 sigma (SFN) (NM_006142) Human Tagged ORF Clone
RG204045

USD 460.00

In Stock

SFN (GFP-tagged) - Human stratifin (SFN)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
14-3-3 sigma (SFN) (NM_006142) Human Untagged Clone
SC319559

USD 310.00

In Stock

SFN (untagged)-Human stratifin (SFN)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
14-3-3 sigma (SFN) Rabbit Polyclonal Antibody
TA326895

USD 275.00

3 Weeks

Rabbit anti-SFN Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SFN
14-3-3 sigma (SFN) Rabbit Polyclonal Antibody
TA590217

USD 409.00

In Stock

Rabbit Polyclonal 14-3-3 sigma/Stratifin Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.
14-3-3 sigma (SFN) (NM_006142) Human Over-expression Lysate
LY401850

USD 396.00

In Stock

Transient overexpression lysate of stratifin (SFN)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
14-3-3 sigma (SFN) (NM_006142) Human Tagged ORF Clone
RC204045L2

USD 620.00

3 Weeks

Lenti ORF clone of Human stratifin (SFN), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
14-3-3 sigma (SFN) (NM_006142) Human Over-expression Lysate
LC401850

USD 121.00

In Stock

SFN HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
14-3-3 sigma (SFN) Goat Polyclonal Antibody
TA302401

USD 375.00

5 Days

Goat Polyclonal Antibody against 14-3-3 sigma / Stratifin

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DLHTLSEDSYKDST, from the internal region of the protein sequence according to NP_006133.1.
14-3-3 sigma (SFN) Rabbit Polyclonal Antibody
TA337133

USD 424.00

5 Days

Rabbit Polyclonal 14-3-3 sigma/Stratifin Antibody

Applications IHC, WB
Reactivities Human, Amphibian, Bovine, Canine, Equine, Opossum
Conjugation Unconjugated
Immunogen A portion of amino acids 120-170 of human 14-3-3 sigma was used as the immunogen for this antibody.
14-3-3 sigma (SFN) Rabbit Polyclonal Antibody
TA324655

USD 450.00

5 Days

Rabbit polyclonal SFN Antibody (Center)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This SFN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 120-149 amino acids from the Central region of human SFN.
14-3-3 sigma (SFN) Rabbit Polyclonal Antibody
TA334404

USD 375.00

5 Days

Rabbit Polyclonal Anti-SFN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SFN antibody: synthetic peptide directed towards the N terminal of human SFN. Synthetic peptide located within the following region: VVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVL
14-3-3 sigma (SFN) Rabbit Polyclonal Antibody
TA334405

USD 375.00

5 Days

Rabbit Polyclonal Anti-SFN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SFN antibody: synthetic peptide directed towards the middle region of human SFN. Synthetic peptide located within the following region: FHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLT
14-3-3 protein sigma / SFN (1-248) Human Protein
AR09318PU-L

USD 745.00

2 Weeks

14-3-3 protein sigma / SFN (1-248) human recombinant protein, 0.5 mg

Expression Host E. coli
14-3-3 protein sigma / SFN (1-248) Human Protein
AR09318PU-N

USD 300.00

2 Weeks

14-3-3 protein sigma / SFN (1-248) human recombinant protein, 0.1 mg

Expression Host E. coli
14-3-3 sigma (SFN) (NM_006142) Human Mass Spec Standard
PH304045

USD 2,055.00

3 Weeks

SFN MS Standard C13 and N15-labeled recombinant protein (NP_006133)

Tag C-Myc/DDK
Expression Host HEK293
14-3-3 sigma (SFN) ICC Control Block
TB404045

USD 1,040.00

4 Weeks

Transient overexpression of SFN (NM_006142) in HEK293T cells paraffin embedded controls for ICC/IHC staining

14-3-3 sigma (SFN) (NM_006142) Human Recombinant Protein
TP720151

USD 330.00

3 Weeks

Recombinant protein of human stratifin (SFN)

Tag tag free
Expression Host E. coli
14-3-3 sigma (SFN) (NM_006142) Human Recombinant Protein
TP720151L

USD 1,900.00

3 Weeks

Recombinant protein of human stratifin (SFN)

Tag tag free
Expression Host E. coli
14-3-3 sigma (SFN) (NM_006142) Human Recombinant Protein
TP720151M

USD 760.00

3 Weeks

Recombinant protein of human stratifin (SFN)

Tag tag free
Expression Host E. coli
14-3-3 sigma (SFN) (NM_006142) Human Recombinant Protein
TP720151XL

USD 2,800.00

3 Weeks

Recombinant protein of human stratifin (SFN)

Tag tag free
Expression Host E. coli
14-3-3 sigma (SFN) Cytosection
TS404045

USD 225.00

4 Weeks

Transient overexpression of SFN (NM_006142) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

14-3-3 sigma (SFN) Cytosection
TS404045P5

USD 889.00

4 Weeks

Transient overexpression of SFN (NM_006142) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack