Germany
Japan
United Kingdom
China
SIK1 (Myc-DDK-tagged)-Human salt-inducible kinase 1 (SIK1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, SIK1 (Myc-DDK tagged) - Human salt-inducible kinase 1 (SIK1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, SIK1 (mGFP-tagged) - Human salt-inducible kinase 1 (SIK1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
SIK1 (GFP-tagged) - Human salt-inducible kinase 1 (SIK1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human salt-inducible kinase 1 (SIK1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SIK1 (Myc-DDK tagged) - Human salt-inducible kinase 1 (SIK1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human salt-inducible kinase 1 (SIK1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SIK1 (mGFP-tagged) - Human salt-inducible kinase 1 (SIK1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
SIK1 (untagged)-Human salt-inducible kinase 1 (SIK1)
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human salt-inducible kinase 1 (SIK1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
SIK1 (untagged)-Kinase deficient mutant (K56M) of Human salt-inducible kinase 1 (SIK1)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human salt-inducible kinase 1 (SIK1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
SIK1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of salt-inducible kinase 1 (SIK1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit polyclonal SIK (Ab-182) antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human SIK around the phosphorylation site of threonine 182 (L-S-TP-W-C). |
Rabbit Polyclonal Anti-SNF1LK Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-SNF1LK antibody: synthetic peptide directed towards the N terminal of human SNF1LK. Synthetic peptide located within the following region: MVIMSEFSADPAGQGQGQQKPLRVGFYDIERTLGKGNFAVVKLARHRVTK |
Purified recombinant protein of Human salt-inducible kinase 1 (SIK1),Tyr27-Met278, with N-terminal His tag, expressed in E. coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Transient overexpression of SIK1 (NM_173354) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human salt-inducible kinase 1 (SIK1), 50ug
| Tag | N-GST and C-HIS |
| Expression Host | E. coli |
Transient overexpression of SIK1 (NM_173354) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SIK1 (NM_173354) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- SIK1
Families
- Druggable Genome