Germany
Japan
United Kingdom
China
SIK1 (Myc-DDK-tagged)-Human salt-inducible kinase 1 (SIK1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, SIK1 (Myc-DDK tagged) - Human salt-inducible kinase 1 (SIK1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, SIK1 (mGFP-tagged) - Human salt-inducible kinase 1 (SIK1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
SIK1 (GFP-tagged) - Human salt-inducible kinase 1 (SIK1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Sik1 (Myc-DDK-tagged) - Mouse salt inducible kinase 1 (Sik1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SIK1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN406169 is the updated version of KN206169.
Sik1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN515784 is the updated version of KN315784.
Sik1 (GFP-tagged) - Mouse salt inducible kinase 1 (Sik1), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Sik1 (Myc-DDK-tagged) - Mouse salt inducible kinase 1 (Sik1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Sik1 (Myc-DDK-tagged) - Mouse salt inducible kinase 1 (Sik1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Sik1 (mGFP-tagged) - Mouse salt inducible kinase 1 (Sik1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Sik1 (GFP-tagged) - Mouse salt inducible kinase 1 (Sik1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human salt-inducible kinase 1 (SIK1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SIK1 (Myc-DDK tagged) - Human salt-inducible kinase 1 (SIK1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human salt-inducible kinase 1 (SIK1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SIK1 (mGFP-tagged) - Human salt-inducible kinase 1 (SIK1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Sik1 (Myc-DDK-tagged ORF) - Rat SNF1-like kinase (Snf1lk), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Sik1 (Myc-DDK-tagged ORF) - Rat SNF1-like kinase (Snf1lk), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Sik1 (Myc-DDK-tagged ORF) - Rat SNF1-like kinase (Snf1lk), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Sik1 (mGFP-tagged ORF) - Rat SNF1-like kinase (Snf1lk), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Sik1 (GFP-tagged ORF) - Rat SNF1-like kinase (Snf1lk), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
SIK1 (untagged)-Human salt-inducible kinase 1 (SIK1)
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human salt-inducible kinase 1 (SIK1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
SIK1 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
SIK1 (untagged)-Kinase deficient mutant (K56M) of Human salt-inducible kinase 1 (SIK1)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Sik1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Lenti ORF clone of Human salt-inducible kinase 1 (SIK1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Sik1 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
SIK1 - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector
| Format | Retroviral plasmids |
| Vector | pRFP-C-RS |
SIK1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of salt-inducible kinase 1 (SIK1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal SIK (Ab-182) antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human SIK around the phosphorylation site of threonine 182 (L-S-TP-W-C). |
Rabbit Polyclonal Anti-SNF1LK Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-SNF1LK antibody: synthetic peptide directed towards the N terminal of human SNF1LK. Synthetic peptide located within the following region: MVIMSEFSADPAGQGQGQQKPLRVGFYDIERTLGKGNFAVVKLARHRVTK |
Purified recombinant protein of Human salt-inducible kinase 1 (SIK1),Tyr27-Met278, with N-terminal His tag, expressed in E. coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
SIK1 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | GFP-puro |
Sik1 (untagged) - Mouse salt inducible kinase 1 (Sik1), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Sik1 (untagged ORF) - Rat SNF1-like kinase (Snf1lk), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
SIK1 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
SIK1 CRISPRa kit - CRISPR gene activation of human salt inducible kinase 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Sik1 CRISPRa kit - CRISPR gene activation of mouse salt inducible kinase 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene SNF1LK
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene SIK1
SIK1 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | mBFP-Neo |
SIK1 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | Luciferase-Puro |
SIK1 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | RFP-BSD |
qSTAR qPCR primer pairs against Mus musculus gene Sik1
Sik1 Antibody - middle region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- SIK1