Germany
Japan
United Kingdom
China
THOP1 (Myc-DDK-tagged)-Human thimet oligopeptidase 1 (THOP1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human thimet oligopeptidase 1 (THOP1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
THOP1 (GFP-tagged) - Human thimet oligopeptidase 1 (THOP1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human thimet oligopeptidase 1 (THOP1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human thimet oligopeptidase 1 (THOP1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,010.00
6 Weeks
Lenti ORF particles, THOP1 (Myc-DDK tagged) - Human thimet oligopeptidase 1 (THOP1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 1,010.00
3 Weeks
Lenti ORF particles, THOP1 (mGFP-tagged) - Human thimet oligopeptidase 1 (THOP1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
THOP1 (untagged)-Human thimet oligopeptidase 1 (THOP1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-THOP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-THOP1 antibody is: synthetic peptide directed towards the C-terminal region of Human THOP1. Synthetic peptide located within the following region: MDYRSCILRPGGSEDASAMLRRFLGRDPKQDAFLLSKGLQVGGCEPEPQV |
THOP1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Transient overexpression lysate of thimet oligopeptidase 1 (THOP1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
(untagged)-Human cDNA FLJ36073 fis, clone TESTI2019697, highly similar to THIMET OLIGOPEPTIDASE (EC 3.4.24.15)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
THOP1 (untagged)-Human thimet oligopeptidase 1 (THOP1)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
USD 465.00
4 Weeks
THOP1 MS Standard C13 and N15-labeled recombinant protein (NP_003240)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
USD 379.00
In Stock
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
2 Days
Transient overexpression of THOP1 (NM_003249) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human thimet oligopeptidase 1 (THOP1)
| Tag | C-His |
| Expression Host | E. coli |
Recombinant protein of human thimet oligopeptidase 1 (THOP1)
| Tag | C-His |
| Expression Host | E. coli |
Recombinant protein of human thimet oligopeptidase 1 (THOP1)
| Tag | C-His |
| Expression Host | E. coli |
Recombinant protein of human thimet oligopeptidase 1 (THOP1)
| Tag | C-His |
| Expression Host | E. coli |
Transient overexpression of THOP1 (NM_003249) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of THOP1 (NM_003249) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- THOP1
Families
- Druggable Genome