Germany
Japan
United Kingdom
China
USD 1,020.00
3 Weeks
Lenti ORF particles, UBE2K (Myc-DDK tagged) - Human ubiquitin-conjugating enzyme E2K (UBE2K), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
-
Products
View as table Download
UBE2K (Myc-DDK-tagged)-Human ubiquitin-conjugating enzyme E2K (UBE2K), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
UBE2K (Myc-DDK-tagged)-Human ubiquitin-conjugating enzyme E2K (UBE2K), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Lenti ORF particles, UBE2K (mGFP-tagged) - Human ubiquitin-conjugating enzyme E2K (UBE2K), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Recombinant protein of human ubiquitin-conjugating enzyme E2K (UBC1 homolog, yeast) (UBE2K), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
UBE2K (GFP-tagged) - Human ubiquitin-conjugating enzyme E2K (UBE2K), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human ubiquitin-conjugating enzyme E2K (UBE2K), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, UBE2K (Myc-DDK tagged) - Human ubiquitin-conjugating enzyme E2K (UBE2K), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ubiquitin-conjugating enzyme E2K (UBE2K), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, UBE2K (mGFP-tagged) - Human ubiquitin-conjugating enzyme E2K (UBE2K), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ubiquitin-conjugating enzyme E2K (UBE2K), transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, UBE2K (Myc-DDK tagged) - Human ubiquitin-conjugating enzyme E2K (UBE2K), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ubiquitin-conjugating enzyme E2K (UBE2K), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, UBE2K (mGFP-tagged) - Human ubiquitin-conjugating enzyme E2K (UBE2K), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
UBE2K (Myc-DDK-tagged)-Human ubiquitin-conjugating enzyme E2K (UBE2K), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of UBE2K (Myc-DDK-tagged)-Human ubiquitin-conjugating enzyme E2K (UBE2K), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
11 Weeks
Lenti ORF particles, UBE2K (Myc-DDK-tagged)-Human ubiquitin-conjugating enzyme E2K (UBE2K), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of UBE2K (mGFP-tagged)-Human ubiquitin-conjugating enzyme E2K (UBE2K), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
11 Weeks
Lenti ORF particles, UBE2K (mGFP-tagged)-Human ubiquitin-conjugating enzyme E2K (UBE2K), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
UBE2K (GFP-tagged) - Human ubiquitin-conjugating enzyme E2K (UBE2K), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
UBE2K (GFP-tagged) - Human ubiquitin-conjugating enzyme E2K (UBE2K), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human ubiquitin-conjugating enzyme E2K (UBE2K), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
UBE2K (untagged)-Human ubiquitin-conjugating enzyme E2K (UBE2K), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-UBE2K Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UBE2K antibody: synthetic peptide directed towards the middle region of human UBE2K. Synthetic peptide located within the following region: TVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPV |
Rabbit Polyclonal Anti-UBE2K Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UBE2K antibody: synthetic peptide directed towards the N terminal of human UBE2K. Synthetic peptide located within the following region: FTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNIS |
HIP2 (UBE2K) (144-157) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Bat, Bovine, Canine, Chicken, Equine, Goat, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Xenopus, Zebrafish |
| Immunogen | Synthetic peptide from C-terminus of human HIP2 (aa 144-157) |
Transient overexpression lysate of ubiquitin-conjugating enzyme E2K (UBC1 homolog, yeast) (UBE2K), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human ubiquitin-conjugating enzyme E2K (UBE2K), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
UBE2K HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
(untagged)-Homo sapiens, clone MGC:12679 IMAGE:3946309, complete cds
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Goat Polyclonal Antibody against HIP2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SWDVETATELLLSN, from the C Terminus of the protein sequence according to NP_005330. |
Anti-UBE2K Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Rabbit polyclonal UBE2K Antibody(N-term)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This UBE2K antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 2-30 amino acids from the N-terminal region of human UBE2K. |
HIP2 / UBE2K (1-200, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
HIP2 / UBE2K (1-200, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
UBE2K HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of ubiquitin-conjugating enzyme E2K (UBC1 homolog, yeast) (UBE2K), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
UBE2K MS Standard C13 and N15-labeled recombinant protein (NP_005330)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
UBE2K (untagged)-Human ubiquitin-conjugating enzyme E2K (UBE2K), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
UBE2K (untagged)-Human ubiquitin-conjugating enzyme E2K (UBE2K), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
HIP2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HIP2 |
UBE2K Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human UBE2K |
Transient overexpression of UBE2K (NM_005339) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of UBE2K (NM_001111113) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of UBE2K (NM_001111112) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human ubiquitin-conjugating enzyme E2K (UBC1 homolog, yeast) (UBE2K), transcript variant 3
| Tag | N-GST |
| Expression Host | E. coli |
Recombinant protein of human ubiquitin-conjugating enzyme E2K (UBC1 homolog, yeast) (UBE2K), transcript variant 3
| Tag | N-GST |
| Expression Host | E. coli |
Recombinant protein of human ubiquitin-conjugating enzyme E2K (UBC1 homolog, yeast) (UBE2K), transcript variant 3
| Tag | N-GST |
| Expression Host | E. coli |
Recombinant protein of human ubiquitin-conjugating enzyme E2K (UBC1 homolog, yeast) (UBE2K), transcript variant 3
| Tag | N-GST |
| Expression Host | E. coli |
Purified recombinant protein of Human ubiquitin-conjugating enzyme E2K (UBE2K), transcript variant 1
| Tag | N-His&SUMO |
| Expression Host | E. coli |
Active filters
Target Symbol
- UBE2K
Families
- Druggable Genome