SMAD6 (Myc-DDK-tagged)-Human SMAD family member 6 (SMAD6), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SMAD6 (Myc-DDK-tagged)-Human SMAD family member 6 (SMAD6), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human SMAD family member 6 (SMAD6), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, SMAD6 (Myc-DDK tagged) - Human SMAD family member 6 (SMAD6), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, SMAD6 (mGFP-tagged) - Human SMAD family member 6 (SMAD6), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
SMAD6 (Myc-DDK-tagged)-Human SMAD family member 6 (SMAD6), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SMAD6 (GFP-tagged) - Human SMAD family member 6 (SMAD6), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of SMAD6 (Myc-DDK-tagged)-Human SMAD family member 6 (SMAD6), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SMAD6 (Myc-DDK-tagged)-Human SMAD family member 6 (SMAD6), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of SMAD6 (mGFP-tagged)-Human SMAD family member 6 (SMAD6), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SMAD6 (mGFP-tagged)-Human SMAD family member 6 (SMAD6), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human SMAD family member 6 (SMAD6), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SMAD6 (Myc-DDK tagged) - Human SMAD family member 6 (SMAD6), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human SMAD family member 6 (SMAD6), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SMAD6 (mGFP-tagged) - Human SMAD family member 6 (SMAD6), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
SMAD6 (GFP-tagged) - Human SMAD family member 6 (SMAD6), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
SMAD6 (untagged)-Human SMAD family member 6 (SMAD6), transcript variant 1
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human SMAD family member 6 (SMAD6), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human SMAD family member 6 (SMAD6), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
SMAD6 (untagged)-Human SMAD family member 6 (SMAD6), transcript variant 1
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of SMAD family member 6 (SMAD6), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
SMAD6 mouse monoclonal antibody, clone 4C8
Applications | ELISA, IHC, WB |
Reactivities | Human |
SMAD6 (285-385) mouse monoclonal antibody, clone 4F3, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
SMAD6 (285-385) mouse monoclonal antibody, clone 2A6, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
SMAD6 mouse monoclonal antibody, clone 1G2
Applications | ELISA, IHC, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-SMAD6 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SMAD6 antibody: synthetic peptide directed towards the N terminal of human SMAD6. Synthetic peptide located within the following region: APRDASDPLAGAALEPAGGGRSREARSRLLLLEQELKTVTYSLLKR |
SMAD6 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit polyclonal SMAD6 Antibody (Center)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This SMAD6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 358-386 amino acids from the Central region of human SMAD6. |
Rabbit Polyclonal Anti-SMAD6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SMAD6 antibody: synthetic peptide directed towards the N terminal of human SMAD6. Synthetic peptide located within the following region: GAPRDASDPLAGAALEPAGGGRSREARSRLLLLEQELKTVTYSLLKRLKE |
Rabbit Polyclonal SMAD6 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Primate, Sheep |
Conjugation | Unconjugated |
Immunogen | This antibody was developed against 2 synthetic peptides found between amino acids 30-150 and 300-400 of human SMAD6 (GenBank Accession No. AAH12986.1). These peptide sequences are specific to SMAD6, and have high homology to SMAD6 in multiple species. |
SMAD6 rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Rabbit Polyclonal Anti-SMAD6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SMAD6 antibody is: synthetic peptide directed towards the N-terminal region of Human SMAD6. Synthetic peptide located within the following region: RRLWRSRVVPDREEGGSGGGGGGDEDGSLGSRAEPAPRAREGGGCGRSEV |
SMAD6 MS Standard C13 and N15-labeled recombinant protein (NP_001136333)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
SMAD6 (untagged)-Human SMAD family member 6 (SMAD6), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of SMAD6 (NM_005585) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SMAD6 (NM_001142861) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SMAD6 (NM_005585) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SMAD6 (NM_005585) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of SMAD6 (NM_001142861) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SMAD6 (NM_001142861) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack