Products

View as table Download

CEBPB (untagged)-Human CCAAT/enhancer binding protein (C/EBP), beta (CEBPB)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

CEBPB (GFP-tagged) - Human CCAAT/enhancer binding protein (C/EBP), beta (CEBPB)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

CEBPB (myc-DDK-tagged) - Human CCAAT/enhancer binding protein (C/EBP), beta (CEBPB), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human CCAAT/enhancer binding protein (C/EBP), beta (CEBPB), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human CCAAT/enhancer binding protein (C/EBP), beta (CEBPB), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CEBPB (Myc-DDK tagged) - Human CCAAT/enhancer binding protein (C/EBP), beta (CEBPB), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

CEBPB (myc-DDK-tagged) - Human CCAAT/enhancer binding protein (C/EBP), beta (CEBPB), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Transient overexpression lysate of CCAAT/enhancer binding protein (C/EBP), beta (CEBPB)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal Anti-CEBPB Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CEBPB antibody: synthetic peptide directed towards the N terminal of human CEBPB. Synthetic peptide located within the following region: AIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDL

Rabbit Polyclonal C/EBP- beta (Thr235/188) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human C/EBP- beta around the phosphorylation site of Threonine 235/188
Modifications Phospho-specific

CEBPB HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal Anti-CEBPB Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CEBPB Antibody: A synthesized peptide derived from human CEBPB

Lenti ORF clone of Human CCAAT/enhancer binding protein (C/EBP), beta (CEBPB), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

CEBPB (untagged) - Human CCAAT/enhancer binding protein (C/EBP), beta (CEBPB), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit polyclonal C/EBP-beta (Ab-235/188) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human C/EBP-β around the phosphorylation site of threonine 235 (P-G-T-P-S).

Rabbit Polyclonal C/EBP-beta Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human C/EBP-beta

CEBP Beta (CEBPB) (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human CEBPB

Rabbit polyclonal anti-CEBPB antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CEBPB.

Anti-CEBPB Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence around aa.336~340(E-P-L-L-A) derived from Human C/EBPβ.

Rabbit Polyclonal anti-CEBPB antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CEBPB antibody: synthetic peptide directed towards the C terminal of human CEBPB. Synthetic peptide located within the following region: ADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKS

CEBPB MS Standard C13 and N15-labeled recombinant protein (NP_005185)

Tag C-Myc/DDK
Expression Host HEK293

CEBPB (GFP-tagged) - Human CCAAT/enhancer binding protein (C/EBP), beta (CEBPB), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

CEBPB (GFP-tagged) - Human CCAAT/enhancer binding protein (C/EBP), beta (CEBPB), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

CEBPB (untagged) - Human CCAAT/enhancer binding protein (C/EBP), beta (CEBPB), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit Polyclonal Anti-CEBPB Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CEBPB

Transient overexpression of CEBPB (NM_005194) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of CEBPB (NM_001285879) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of CEBPB (NM_001285878) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of CEBPB (NM_005194) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of CEBPB (NM_005194) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of CEBPB (NM_001285879) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of CEBPB (NM_001285878) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of CEBPB (NM_001285878) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack