CEBPB (untagged)-Human CCAAT/enhancer binding protein (C/EBP), beta (CEBPB)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
CEBPB (untagged)-Human CCAAT/enhancer binding protein (C/EBP), beta (CEBPB)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
CEBPB (Myc-DDK-tagged)-Human CCAAT/enhancer binding protein (C/EBP), beta (CEBPB)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human CCAAT/enhancer binding protein (C/EBP), beta (CEBPB)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
CEBPB (GFP-tagged) - Human CCAAT/enhancer binding protein (C/EBP), beta (CEBPB)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, CEBPB (Myc-DDK tagged) - Human CCAAT/enhancer binding protein (C/EBP), beta (CEBPB), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, CEBPB (mGFP-tagged) - Human CCAAT/enhancer binding protein (C/EBP), beta (CEBPB), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
CEBPB (myc-DDK-tagged) - Human CCAAT/enhancer binding protein (C/EBP), beta (CEBPB), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human CCAAT/enhancer binding protein (C/EBP), beta (CEBPB), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human CCAAT/enhancer binding protein (C/EBP), beta (CEBPB), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, CEBPB (Myc-DDK tagged) - Human CCAAT/enhancer binding protein (C/EBP), beta (CEBPB), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, CEBPB (mGFP-tagged) - Human CCAAT/enhancer binding protein (C/EBP), beta (CEBPB), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CEBPB (myc-DDK-tagged) - Human CCAAT/enhancer binding protein (C/EBP), beta (CEBPB), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of CCAAT/enhancer binding protein (C/EBP), beta (CEBPB)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human CCAAT/enhancer binding protein (C/EBP), beta (CEBPB), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-CEBPB Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CEBPB antibody: synthetic peptide directed towards the N terminal of human CEBPB. Synthetic peptide located within the following region: AIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDL |
Rabbit Polyclonal C/EBP- beta (Thr235/188) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human C/EBP- beta around the phosphorylation site of Threonine 235/188 |
Modifications | Phospho-specific |
CEBPB HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-CEBPB Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CEBPB Antibody: A synthesized peptide derived from human CEBPB |
Lenti ORF clone of Human CCAAT/enhancer binding protein (C/EBP), beta (CEBPB), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
CEBPB (untagged) - Human CCAAT/enhancer binding protein (C/EBP), beta (CEBPB), transcript variant 1
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit polyclonal C/EBP-beta (Ab-235/188) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human C/EBP-β around the phosphorylation site of threonine 235 (P-G-T-P-S). |
Rabbit Polyclonal C/EBP-beta Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human C/EBP-beta |
CEBP Beta (CEBPB) (C-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human CEBPB |
Rabbit polyclonal anti-CEBPB antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CEBPB. |
Anti-CEBPB Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.336~340(E-P-L-L-A) derived from Human C/EBPβ. |
Rabbit Polyclonal anti-CEBPB antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CEBPB antibody: synthetic peptide directed towards the C terminal of human CEBPB. Synthetic peptide located within the following region: ADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKS |
CEBPB MS Standard C13 and N15-labeled recombinant protein (NP_005185)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
CEBPB (GFP-tagged) - Human CCAAT/enhancer binding protein (C/EBP), beta (CEBPB), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CEBPB (GFP-tagged) - Human CCAAT/enhancer binding protein (C/EBP), beta (CEBPB), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CEBPB (untagged) - Human CCAAT/enhancer binding protein (C/EBP), beta (CEBPB), transcript variant 1
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-CEBPB Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CEBPB |
Transient overexpression of CEBPB (NM_005194) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CEBPB (NM_001285879) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CEBPB (NM_001285878) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CEBPB (NM_005194) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CEBPB (NM_005194) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CEBPB (NM_001285879) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CEBPB (NM_001285878) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CEBPB (NM_001285878) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack