Products

Proteins (13)
cDNA Clones (7)
Antibodies (1)
Jump to Filters
View as table Download
HBZ (NM_005332) Human Tagged ORF Clone
RC206504

USD 98.00

USD 390.00

In Stock

HBZ (Myc-DDK-tagged)-Human hemoglobin, zeta (HBZ)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
HBZ (NM_005332) Human Tagged ORF Clone
RG206504

USD 460.00

In Stock

HBZ (GFP-tagged) - Human hemoglobin, zeta (HBZ)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
HBZ (NM_005332) Human Tagged ORF Clone
RC206504L3

USD 620.00

3 Weeks

Lenti ORF clone of Human hemoglobin, zeta (HBZ), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HBZ (NM_005332) Human Tagged ORF Clone
RC206504L4

USD 620.00

3 Weeks

Lenti ORF clone of Human hemoglobin, zeta (HBZ), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HBZ Rabbit Polyclonal Antibody
TA346403

USD 410.00

5 Days

Rabbit Polyclonal Anti-HBZ Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HBZ antibody: synthetic peptide directed towards the N terminal of human HBZ. Synthetic peptide located within the following region: ERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGA
HBZ (NM_005332) Human Untagged Clone
SC122708

USD 310.00

In Stock

HBZ (untagged)-Human hemoglobin, zeta (HBZ)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
HBZ (NM_005332) Human Over-expression Lysate
LY417379

USD 396.00

5 Days

Transient overexpression lysate of hemoglobin, zeta (HBZ)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
HBZ (1-142, His-tag) Human Protein
AR09428PU-L

USD 745.00

2 Weeks

HBZ (1-142, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
HBZ (1-142, His-tag) Human Protein
AR09428PU-N

USD 300.00

2 Weeks

HBZ (1-142, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
HBZ (NM_005332) Human Over-expression Lysate
LC417379

USD 121.00

2 Weeks

HBZ HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
HBZ (NM_005332) Human Mass Spec Standard
PH306504

USD 2,055.00

3 Weeks

HBZ MS Standard C13 and N15-labeled recombinant protein (NP_005323)

Tag C-Myc/DDK
Expression Host HEK293
HBZ ICC Control Block
TB406504

USD 1,040.00

4 Weeks

Transient overexpression of HBZ (NM_005332) in HEK293T cells paraffin embedded controls for ICC/IHC staining

HBZ (NM_005332) Human Recombinant Protein
TP720205

USD 330.00

3 Weeks

Recombinant protein of human hemoglobin, zeta (HBZ)

Tag N-His
Expression Host E. coli
HBZ (NM_005332) Human Recombinant Protein
TP720205L

USD 1,900.00

3 Weeks

Recombinant protein of human hemoglobin, zeta (HBZ)

Tag N-His
Expression Host E. coli
HBZ (NM_005332) Human Recombinant Protein
TP720205M

USD 760.00

3 Weeks

Recombinant protein of human hemoglobin, zeta (HBZ)

Tag N-His
Expression Host E. coli
HBZ (NM_005332) Human Recombinant Protein
TP720205XL

USD 2,800.00

3 Weeks

Recombinant protein of human hemoglobin, zeta (HBZ)

Tag N-His
Expression Host E. coli
HBZ Cytosection
TS406504

USD 225.00

4 Weeks

Transient overexpression of HBZ (NM_005332) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

HBZ Cytosection
TS406504P5

USD 889.00

4 Weeks

Transient overexpression of HBZ (NM_005332) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack