HBZ (Myc-DDK-tagged)-Human hemoglobin, zeta (HBZ)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HBZ (Myc-DDK-tagged)-Human hemoglobin, zeta (HBZ)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human hemoglobin, zeta (HBZ)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
HBZ (GFP-tagged) - Human hemoglobin, zeta (HBZ)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
HBZ - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Lenti ORF clone of Human hemoglobin, zeta (HBZ), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, HBZ (Myc-DDK tagged) - Human hemoglobin, zeta (HBZ), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human hemoglobin, zeta (HBZ), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, HBZ (mGFP-tagged) - Human hemoglobin, zeta (HBZ), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Hbz (myc-DDK-tagged) - Rat hemoglobin, zeta (Hbz)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-HBZ Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HBZ antibody: synthetic peptide directed towards the N terminal of human HBZ. Synthetic peptide located within the following region: ERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGA |
HBZ (untagged)-Human hemoglobin, zeta (HBZ)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression lysate of hemoglobin, zeta (HBZ)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
HBZ (1-142, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
HBZ (1-142, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
HBZ CRISPRa kit - CRISPR gene activation of human hemoglobin subunit zeta
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene HBZ
Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene HBZ
Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
HBZ HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
HBZ MS Standard C13 and N15-labeled recombinant protein (NP_005323)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
AAV ORF Particles, serotype AAV-2, HBZ (Myc-DDK-tagged)-Human hemoglobin, zeta (HBZ), 250ul, >10^13 TU/mL
Hbz (untagged) - Rat hemoglobin, zeta (Hbz)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
3`UTR clone of hemoglobin zeta (HBZ) for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |
HBZ (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
HBZ rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HBZ |
HBZ rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HBZ |
HBZ Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-142 of human HBZ (NP_005323.1). |
Modifications | Unmodified |
Transient overexpression of HBZ (NM_005332) in HEK293T cells paraffin embedded controls for ICC/IHC staining
HBZ - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
Format | Lentiviral plasmids |
Vector | pGFP-C-shLenti |
E. coli Selection | Chloramphenicol |
Mammalian Cell Selection | Puromycin |
HBZ - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
Format | Lentiviral particles |
Vector | pGFP-C-shLenti |
Recombinant protein of human hemoglobin, zeta (HBZ)
Tag | N-His |
Expression Host | E. coli |
Recombinant protein of human hemoglobin, zeta (HBZ)
Tag | N-His |
Expression Host | E. coli |
Recombinant protein of human hemoglobin, zeta (HBZ)
Tag | N-His |
Expression Host | E. coli |
Recombinant protein of human hemoglobin, zeta (HBZ)
Tag | N-His |
Expression Host | E. coli |
HBZ - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
Format | Retroviral plasmids |
Vector | pRS |
E. coli Selection | Ampicillin |
Mammalian Cell Selection | Puromycin |
Transient overexpression of HBZ (NM_005332) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of HBZ (NM_005332) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack