Products

View as table Download

USD 98.00

USD 390.00

In Stock

HBZ (Myc-DDK-tagged)-Human hemoglobin, zeta (HBZ)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human hemoglobin, zeta (HBZ)

Tag C-Myc/DDK
Expression Host HEK293T

HBZ (GFP-tagged) - Human hemoglobin, zeta (HBZ)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

HBZ - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN406504 is the updated version of KN206504.

Lenti ORF clone of Human hemoglobin, zeta (HBZ), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human hemoglobin, zeta (HBZ), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Hbz (myc-DDK-tagged) - Rat hemoglobin, zeta (Hbz)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit Polyclonal Anti-HBZ Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HBZ antibody: synthetic peptide directed towards the N terminal of human HBZ. Synthetic peptide located within the following region: ERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGA

HBZ (untagged)-Human hemoglobin, zeta (HBZ)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

HBZ (1-142, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli

HBZ (1-142, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli

HBZ CRISPRa kit - CRISPR gene activation of human hemoglobin subunit zeta

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

qPCR primer pairs and template standards against Homo sapiens gene HBZ

Application Plasmid of exact quantity for transcript copy number calculation

qSTAR qPCR primer pairs against Homo sapiens gene HBZ

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)

HBZ HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

HBZ MS Standard C13 and N15-labeled recombinant protein (NP_005323)

Tag C-Myc/DDK
Expression Host HEK293

AAV ORF Particles, serotype AAV-2, HBZ (Myc-DDK-tagged)-Human hemoglobin, zeta (HBZ), 250ul, >10^13 TU/mL

  • AAV ORF®

Hbz (untagged) - Rat hemoglobin, zeta (Hbz)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

3`UTR clone of hemoglobin zeta (HBZ) for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase

HBZ (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

HBZ rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human HBZ

HBZ rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human HBZ

HBZ Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-142 of human HBZ (NP_005323.1).
Modifications Unmodified

USD 1,040.00

4 Weeks

Transient overexpression of HBZ (NM_005332) in HEK293T cells paraffin embedded controls for ICC/IHC staining

HBZ - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
E. coli Selection Chloramphenicol
Mammalian Cell Selection Puromycin

HBZ - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti

Recombinant protein of human hemoglobin, zeta (HBZ)

Tag N-His
Expression Host E. coli

Recombinant protein of human hemoglobin, zeta (HBZ)

Tag N-His
Expression Host E. coli

Recombinant protein of human hemoglobin, zeta (HBZ)

Tag N-His
Expression Host E. coli

Recombinant protein of human hemoglobin, zeta (HBZ)

Tag N-His
Expression Host E. coli

HBZ - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
E. coli Selection Ampicillin
Mammalian Cell Selection Puromycin

USD 225.00

4 Weeks

Transient overexpression of HBZ (NM_005332) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of HBZ (NM_005332) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack